mRNA_H-paniculata_contig10535.349.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: A0A482SQF6_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SQF6_9ARCH) HSP 1 Score: 122 bits (305), Expect = 1.340e-31 Identity = 46/63 (73.02%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 QDNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFG 189 QD K +YRSDFFPGLGW++ R +W+EL KWPKAYWDDWLR+PAQRQ RQF+RPE+CRT H+G Sbjct: 220 QDTKQLYRSDFFPGLGWMLSRRIWEELGPKWPKAYWDDWLREPAQRQSRQFIRPEVCRTLHYG 282
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: D7FXV4_ECTSI (Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase, family GT13 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FXV4_ECTSI) HSP 1 Score: 123 bits (308), Expect = 1.520e-31 Identity = 46/65 (70.77%), Postives = 59/65 (90.77%), Query Frame = 1 Query: 1 QDNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGKK 195 +DN+A++RSDFFPGLGW++ R VW EL+ WP+AYWDDWLRDP +R+GRQF+RPE+CRTYHFG+K Sbjct: 342 KDNRALFRSDFFPGLGWMLPRRVWDELAADWPEAYWDDWLRDPRRRKGRQFIRPEVCRTYHFGQK 406
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: A0A6H5L776_9PHAE (GT13 protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L776_9PHAE) HSP 1 Score: 122 bits (306), Expect = 2.550e-31 Identity = 46/64 (71.88%), Postives = 58/64 (90.62%), Query Frame = 1 Query: 4 DNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGKK 195 DNKA++RSDFFPGLGW++ R VW EL+ WP+AYWDDWLRDP +R+GRQF+RPE+CRT+HFG+K Sbjct: 245 DNKALFRSDFFPGLGWMLPRRVWDELAADWPEAYWDDWLRDPRRRKGRQFIRPEVCRTFHFGQK 308
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: A0A1U7WJI4_NICSY (Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase n=2 Tax=Nicotiana sylvestris TaxID=4096 RepID=A0A1U7WJI4_NICSY) HSP 1 Score: 111 bits (277), Expect = 6.170e-29 Identity = 43/64 (67.19%), Postives = 53/64 (82.81%), Query Frame = 1 Query: 1 QDNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGK 192 QD A+YRSDFFPGLGW++ ++ W ELS KWPKAYWDDWLR +GRQF+RPE+CRTY+FG+ Sbjct: 36 QDPYALYRSDFFPGLGWMLSKSTWDELSPKWPKAYWDDWLRLKENHRGRQFIRPEVCRTYNFGE 99
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: A0A7S2XX81_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2XX81_9STRA) HSP 1 Score: 110 bits (276), Expect = 1.180e-28 Identity = 40/64 (62.50%), Postives = 54/64 (84.38%), Query Frame = 1 Query: 1 QDNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGK 192 +D + +YRSDFFPGLGW+M R +W+E KWP+ YWDDW+R+P QR+GR+ +RPEICRT+HFG+ Sbjct: 62 KDPEMLYRSDFFPGLGWMMPRRLWEEFGPKWPRGYWDDWIREPPQRKGRETIRPEICRTFHFGE 125
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: UPI00090170FD (alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like n=1 Tax=Camelina sativa TaxID=90675 RepID=UPI00090170FD) HSP 1 Score: 109 bits (273), Expect = 2.700e-28 Identity = 43/63 (68.25%), Postives = 52/63 (82.54%), Query Frame = 1 Query: 4 DNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGK 192 D A+YRSDFFPGLGW++ R+ W ELS KWPKAYWDDWLR +GRQF+RPE+CRTY+FG+ Sbjct: 41 DPYALYRSDFFPGLGWMLKRSTWDELSPKWPKAYWDDWLRLKENHKGRQFIRPEVCRTYNFGE 103
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: A0A1Q3ALD2_CEPFO (Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase n=1 Tax=Cephalotus follicularis TaxID=3775 RepID=A0A1Q3ALD2_CEPFO) HSP 1 Score: 113 bits (283), Expect = 2.940e-28 Identity = 44/63 (69.84%), Postives = 54/63 (85.71%), Query Frame = 1 Query: 4 DNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGK 192 D+ A+YRSDFFPGLGW++ R+ W ELS KWPKAYWDDWLR R+GRQF+RPE+CRTY+FG+ Sbjct: 252 DSYALYRSDFFPGLGWMLSRSTWDELSPKWPKAYWDDWLRLKENRKGRQFIRPEVCRTYNFGE 314
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: A0A2R6R743_ACTCC (Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase n=1 Tax=Actinidia chinensis var. chinensis TaxID=1590841 RepID=A0A2R6R743_ACTCC) HSP 1 Score: 112 bits (279), Expect = 3.260e-28 Identity = 44/64 (68.75%), Postives = 53/64 (82.81%), Query Frame = 1 Query: 1 QDNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGK 192 QD A+YRSDFFPGLGW++ ++ W ELS KWPKAYWDDWLR +GRQF+RPEICRTY+FG+ Sbjct: 157 QDPHALYRSDFFPGLGWMLSKSTWNELSPKWPKAYWDDWLRLKENHKGRQFIRPEICRTYNFGE 220
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: A0A2I4GCI0_JUGRE (Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase n=7 Tax=Juglandaceae TaxID=16714 RepID=A0A2I4GCI0_JUGRE) HSP 1 Score: 112 bits (281), Expect = 4.760e-28 Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 1 Query: 4 DNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGK 192 D A+YRSDFFPGLGW++ R+ W ELS KWPKAYWDDWLR R+GRQF+RPEICRTY+FG+ Sbjct: 235 DPYALYRSDFFPGLGWMLARSTWDELSPKWPKAYWDDWLRLKENRKGRQFIRPEICRTYNFGE 297
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Match: A0A540LRR0_MALBA (Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase n=1 Tax=Malus baccata TaxID=106549 RepID=A0A540LRR0_MALBA) HSP 1 Score: 111 bits (277), Expect = 5.110e-28 Identity = 43/63 (68.25%), Postives = 52/63 (82.54%), Query Frame = 1 Query: 4 DNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQFLRPEICRTYHFGK 192 D K +YRSDFFPGLGW++ R+ W ELS KWPKAYWDDWLR +GRQF+RPE+CRTY+FG+ Sbjct: 142 DPKILYRSDFFPGLGWMLARSTWDELSPKWPKAYWDDWLRLQENHKGRQFIRPEVCRTYNFGE 204 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10535.349.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig10535.349.1 >prot_H-paniculata_contig10535.349.1 ID=prot_H-paniculata_contig10535.349.1|Name=mRNA_H-paniculata_contig10535.349.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=65bp QDNKAIYRSDFFPGLGWLMGRTVWQELSGKWPKAYWDDWLRDPAQRQGRQback to top mRNA from alignment at H-paniculata_contig10535:4917..5111+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig10535.349.1 ID=mRNA_H-paniculata_contig10535.349.1|Name=mRNA_H-paniculata_contig10535.349.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=195bp|location=Sequence derived from alignment at H-paniculata_contig10535:4917..5111+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig10535:4917..5111+ >mRNA_H-paniculata_contig10535.349.1 ID=mRNA_H-paniculata_contig10535.349.1|Name=mRNA_H-paniculata_contig10535.349.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=390bp|location=Sequence derived from alignment at H-paniculata_contig10535:4917..5111+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |