mRNA_H-paniculata_contig10290.191.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: A0A6H5JWI1_9PHAE (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWI1_9PHAE) HSP 1 Score: 75.1 bits (183), Expect = 2.760e-14 Identity = 35/63 (55.56%), Postives = 44/63 (69.84%), Query Frame = 1 Query: 52 EIEAYRESAGVALEEELEDGTDRYPDPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 E+ A++ S G+ + EE ++G Y DPL WW C DFP L LARR+LAIPATQA+SER FS Sbjct: 197 ELTAFKVSTGIKMYEEDKEGAKVYLDPLDWWRVRCADFPHLANLARRVLAIPATQAESERLFS 259
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: A0A6H5JHP9_9PHAE (Autophagy protein 5 n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHP9_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 5.650e-9 Identity = 33/79 (41.77%), Postives = 48/79 (60.76%), Query Frame = 1 Query: 16 VDMDPYRRRA----AREIEAYRESAGVALEEELEDGTDRYPDPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 P RR+ +RE++A++ + G+A+ E E G + PL+WW ++P L +LARR+L IPA QAQSER FS Sbjct: 439 ASSSPLRRQMESIISREVDAFKITPGLAVSWE-EKGQEVRGKPLEWWRVKAREYPKLASLARRVLCIPAFQAQSERVFS 516
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: A0A6H5KUY5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUY5_9PHAE) HSP 1 Score: 56.2 bits (134), Expect = 2.340e-7 Identity = 27/60 (45.00%), Postives = 39/60 (65.00%), Query Frame = 1 Query: 52 EIEAYRESAGVALEEELEDGTDRYPDPLQWWNEHCGDFPMLTALARRLLAIPATQAQSER 231 E+ +++ + G+++ DG Y DPL WW +FP L ALARR+LAIP++QA SER Sbjct: 489 EVASFQTTPGISIWYWGTDGKKVYNDPLDWWRTRQMEFPHLAALARRVLAIPSSQAHSER 548
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: A0A6P8TX40_GYMAC (zinc finger BED domain-containing protein 1-like n=1 Tax=Gymnodraco acuticeps TaxID=8218 RepID=A0A6P8TX40_GYMAC) HSP 1 Score: 55.8 bits (133), Expect = 3.190e-7 Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 127 DPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 DPL+WW H G+FP ++ LAR+ L IPAT A SER FS Sbjct: 440 DPLEWWQNHDGNFPRVSQLARKYLCIPATSAPSERVFS 477
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: A0A3B3T1Z0_9TELE (Uncharacterized protein n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=A0A3B3T1Z0_9TELE) HSP 1 Score: 53.1 bits (126), Expect = 2.820e-6 Identity = 23/38 (60.53%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 127 DPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 D L WW EH P L+ +ARR+LAIPAT A SER FS Sbjct: 371 DLLSWWKEHASTLPRLSQIARRILAIPATSAPSERAFS 408
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: A0A6G0WVR8_APHCR (Zinc finger protein 618-like n=1 Tax=Aphis craccivora TaxID=307492 RepID=A0A6G0WVR8_APHCR) HSP 1 Score: 52.4 bits (124), Expect = 5.270e-6 Identity = 23/42 (54.76%), Postives = 28/42 (66.67%), Query Frame = 1 Query: 115 DRYPDPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 D D LQWW EH P++ LA R+LAIPA+ A SER+FS Sbjct: 344 DERQDILQWWKEHSDKLPLMAKLASRILAIPASSAASERSFS 385
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: UPI0011B831FF (zinc finger BED domain-containing protein 1-like isoform X1 n=1 Tax=Gadus morhua TaxID=8049 RepID=UPI0011B831FF) HSP 1 Score: 52.0 bits (123), Expect = 7.120e-6 Identity = 32/73 (43.84%), Postives = 37/73 (50.68%), Query Frame = 1 Query: 22 MDPYRRRAAREIEAYRESAGVALEEELEDGTDRYPDPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 M R RA EI YRE +AL D LQWW + D P+L+ALA+ L IPAT SER FS Sbjct: 290 MKTTRERARAEILKYRERDSLALS----------GDVLQWWKKQV-DLPLLSALAKSYLCIPATSVPSERVFS 351
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: UPI0011B4CD2D (zinc finger BED domain-containing protein 1-like isoform X1 n=2 Tax=Gadus morhua TaxID=8049 RepID=UPI0011B4CD2D) HSP 1 Score: 52.0 bits (123), Expect = 7.370e-6 Identity = 32/73 (43.84%), Postives = 37/73 (50.68%), Query Frame = 1 Query: 22 MDPYRRRAAREIEAYRESAGVALEEELEDGTDRYPDPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 M R RA EI YRE +AL D LQWW + D P+L+ALA+ L IPAT SER FS Sbjct: 538 MKTTRERARAEILKYRERDSLALS----------GDVLQWWKKQV-DLPLLSALAKSYLCIPATSVPSERVFS 599
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: UPI001BF29065 (Uncharacterized protein n=2 Tax=Carya illinoinensis TaxID=32201 RepID=UPI001BF29065) HSP 1 Score: 51.6 bits (122), Expect = 1.010e-5 Identity = 32/78 (41.03%), Postives = 43/78 (55.13%), Query Frame = 1 Query: 7 APLVDMDPYRRRAAREIEAYRESAGVALEEELEDGTDRYPDPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 +PLV ++RRA+R I R L E++E +D + L WW H FP+L+ +AR LLAIP T SE FS Sbjct: 607 SPLVQRY-HQRRASRNIMRCRSEVERYLMEDVEAPSDAF-QLLTWWKVHSTKFPILSRIARDLLAIPITTVASESVFS 682
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Match: UPI001BF8472F (Uncharacterized protein n=1 Tax=Carya illinoinensis TaxID=32201 RepID=UPI001BF8472F) HSP 1 Score: 51.6 bits (122), Expect = 1.020e-5 Identity = 32/78 (41.03%), Postives = 43/78 (55.13%), Query Frame = 1 Query: 7 APLVDMDPYRRRAAREIEAYRESAGVALEEELEDGTDRYPDPLQWWNEHCGDFPMLTALARRLLAIPATQAQSERTFS 240 +PLV ++RRA+R I R L E++E +D + L WW H FP+L+ +AR LLAIP T SE FS Sbjct: 606 SPLVQRY-HQRRASRNIMQCRSEVERYLMEDVEAPSDAF-QLLTWWKVHSTKFPILSRIARDLLAIPITTVASESAFS 681 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10290.191.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig10290.191.1 >prot_H-paniculata_contig10290.191.1 ID=prot_H-paniculata_contig10290.191.1|Name=mRNA_H-paniculata_contig10290.191.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=73bp MDPYRRRAAREIEAYRESAGVALEEELEDGTDRYPDPLQWWNEHCGDFPMback to top mRNA from alignment at H-paniculata_contig10290:135..374- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig10290.191.1 ID=mRNA_H-paniculata_contig10290.191.1|Name=mRNA_H-paniculata_contig10290.191.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=240bp|location=Sequence derived from alignment at H-paniculata_contig10290:135..374- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig10290:135..374- >mRNA_H-paniculata_contig10290.191.1 ID=mRNA_H-paniculata_contig10290.191.1|Name=mRNA_H-paniculata_contig10290.191.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=438bp|location=Sequence derived from alignment at H-paniculata_contig10290:135..374- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |