mRNA_H-paniculata_contig10262.177.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10262.177.1 vs. uniprot
Match: D7G301_ECTSI (Polymorphic Outer membrane protein G/I family n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G301_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 1.770e-6 Identity = 33/76 (43.42%), Postives = 45/76 (59.21%), Query Frame = 1 Query: 1 GGALGS-SLSITGQSPSYLTMNGGTSFLNNWAGENGGGMAITGSLKFNSSETAYITFSGNTADIAGGALFITEAGM 225 GG +GS S S L MNG T+F+NN G NGG +A+ G L N T ++F GN A++AGGA+F++ G Sbjct: 537 GGVIGSFSTDSVSNQGSTLVMNGTTAFVNNTCGANGGALALLGGLAVNIG-TENVSFIGNAAEVAGGAVFVSGTGF 611
BLAST of mRNA_H-paniculata_contig10262.177.1 vs. uniprot
Match: D7FTL7_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FTL7_ECTSI) HSP 1 Score: 52.4 bits (124), Expect = 4.530e-6 Identity = 29/60 (48.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 46 SYLTMNGGTSFLNNWAGENGGGMAITGSLKFNSSETAYITFSGNTADIAGGALFITEAGM 225 S L +NG T+F+NN G +GGG+A L + +TA +TFSGN A++AGGA+F++ AG+ Sbjct: 523 STLLINGPTAFVNNTCGGSGGGLAAFDGLSVDI-DTAGVTFSGNAAEVAGGAVFVSGAGV 581
BLAST of mRNA_H-paniculata_contig10262.177.1 vs. uniprot
Match: D7G2X5_ECTSI (Adhesin-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2X5_ECTSI) HSP 1 Score: 49.3 bits (116), Expect = 5.560e-5 Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 46 SYLTMNGGTSFLNNWAGENGGGMAITGSLKFNSSETAYITFSGNTADIAGGALFITEAGM 225 S L +NG T+F NN GENGG +A+ + + + TA ++F+GN+A AGGA+F++ AG+ Sbjct: 724 SSLVINGTTTFFNNTCGENGGSLALFDACSLDIN-TADVSFTGNSAGFAGGAVFVSGAGI 782 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10262.177.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig10262.177.1 >prot_H-paniculata_contig10262.177.1 ID=prot_H-paniculata_contig10262.177.1|Name=mRNA_H-paniculata_contig10262.177.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=75bp GGALGSSLSITGQSPSYLTMNGGTSFLNNWAGENGGGMAITGSLKFNSSEback to top mRNA from alignment at H-paniculata_contig10262:5725..5950+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig10262.177.1 ID=mRNA_H-paniculata_contig10262.177.1|Name=mRNA_H-paniculata_contig10262.177.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=226bp|location=Sequence derived from alignment at H-paniculata_contig10262:5725..5950+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig10262:5725..5950+ >mRNA_H-paniculata_contig10262.177.1 ID=mRNA_H-paniculata_contig10262.177.1|Name=mRNA_H-paniculata_contig10262.177.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=450bp|location=Sequence derived from alignment at H-paniculata_contig10262:5725..5950+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |