mRNA_H-paniculata_contig10018.26.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: A0A7J7RPJ5_RHIFE (Lysine demethylase 2B n=1 Tax=Rhinolophus ferrumequinum TaxID=59479 RepID=A0A7J7RPJ5_RHIFE) HSP 1 Score: 57.8 bits (138), Expect = 1.130e-9 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC +C CL TEC C FCKDM K+GGPGR++Q+ ++ Sbjct: 52 RCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIM 88
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: A0A2D4JJQ3_MICLE (CXXC-type domain-containing protein (Fragment) n=1 Tax=Micrurus lemniscatus lemniscatus TaxID=129467 RepID=A0A2D4JJQ3_MICLE) HSP 1 Score: 57.8 bits (138), Expect = 1.610e-9 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC +C CL TEC C FCKDM K+GGPGR++Q+ ++ Sbjct: 52 RCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIM 88
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: A0A455B143_PHYMC (lysine-specific demethylase 2B-like n=1 Tax=Physeter macrocephalus TaxID=9755 RepID=A0A455B143_PHYMC) HSP 1 Score: 57.8 bits (138), Expect = 2.180e-9 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC +C CL TEC C FCKDM K+GGPGR++Q+ ++ Sbjct: 52 RCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIM 88
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: A0A5C6NUN2_9TELE (F-box/LRR-repeat protein 19 F-box and leucine-rich repeat protein 19 n=1 Tax=Takifugu flavidus TaxID=433684 RepID=A0A5C6NUN2_9TELE) HSP 1 Score: 55.8 bits (133), Expect = 2.220e-9 Identity = 20/37 (54.05%), Postives = 27/37 (72.97%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC C C+ TEC C FCKDM K+GGPGR++Q+ ++ Sbjct: 21 RCRRCQACMRTECGECHFCKDMKKFGGPGRMKQSCLL 57
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: UPI0018D6E920 (lysine-specific demethylase 2B-like isoform X1 n=2 Tax=Patiria miniata TaxID=46514 RepID=UPI0018D6E920) HSP 1 Score: 59.3 bits (142), Expect = 3.080e-9 Identity = 22/37 (59.46%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC +C CL+ +CR C FCKDM KYGGPGR++Q+ V Sbjct: 636 RCRKCENCLSDDCRDCHFCKDMKKYGGPGRMKQSCVA 672
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: A0A090XCE6_CORC0 (Transient receptor potential-like protein (Fragment) n=1 Tax=Corticium candelabrum TaxID=121492 RepID=A0A090XCE6_CORC0) HSP 1 Score: 59.3 bits (142), Expect = 3.090e-9 Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASV 108 RCGEC GCLA++C C+FC DM KYGG G++RQA + Sbjct: 553 RCGECTGCLASDCIDCRFCLDMIKYGGTGKLRQACM 588
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: UPI00189BBB2C (lysine-specific demethylase 2B n=1 Tax=Nematolebias whitei TaxID=451745 RepID=UPI00189BBB2C) HSP 1 Score: 57.8 bits (138), Expect = 3.470e-9 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC +C CL TEC C FCKDM K+GGPGR++Q+ ++ Sbjct: 52 RCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIM 88
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: A0A6P8S006_GEOSA (lysine-specific demethylase 2B isoform X2 n=6 Tax=Gymnophiona TaxID=8445 RepID=A0A6P8S006_GEOSA) HSP 1 Score: 58.5 bits (140), Expect = 5.750e-9 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC +C CL TEC C FCKDM K+GGPGR++Q+ ++ Sbjct: 575 RCRKCEACLRTECGACHFCKDMKKFGGPGRMKQSCIM 611
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: A0A6P8S2U9_GEOSA (lysine-specific demethylase 2B isoform X3 n=4 Tax=Gymnophiona TaxID=8445 RepID=A0A6P8S2U9_GEOSA) HSP 1 Score: 58.5 bits (140), Expect = 5.750e-9 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC +C CL TEC C FCKDM K+GGPGR++Q+ ++ Sbjct: 575 RCRKCEACLRTECGACHFCKDMKKFGGPGRMKQSCIM 611
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Match: A0A6P8S237_GEOSA (lysine-specific demethylase 2B isoform X5 n=1 Tax=Geotrypetes seraphini TaxID=260995 RepID=A0A6P8S237_GEOSA) HSP 1 Score: 58.5 bits (140), Expect = 5.750e-9 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVV 111 RC +C CL TEC C FCKDM K+GGPGR++Q+ ++ Sbjct: 575 RCRKCEACLRTECGACHFCKDMKKFGGPGRMKQSCIM 611 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10018.26.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig10018.26.1 >prot_H-paniculata_contig10018.26.1 ID=prot_H-paniculata_contig10018.26.1|Name=mRNA_H-paniculata_contig10018.26.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=37bp RCGECPGCLATECRICKFCKDMPKYGGPGRVRQASVVback to top mRNA from alignment at H-paniculata_contig10018:807..917- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig10018.26.1 ID=mRNA_H-paniculata_contig10018.26.1|Name=mRNA_H-paniculata_contig10018.26.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=111bp|location=Sequence derived from alignment at H-paniculata_contig10018:807..917- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig10018:807..917- >mRNA_H-paniculata_contig10018.26.1 ID=mRNA_H-paniculata_contig10018.26.1|Name=mRNA_H-paniculata_contig10018.26.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=222bp|location=Sequence derived from alignment at H-paniculata_contig10018:807..917- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |