Gvermi4313.t1 (polypeptide) Gracilaria vermiculophylla HapMaleFtJ_2017 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Gvermi4313.t1
Unique Name	Gvermi4313.t1
Type	polypeptide
Organism	Gracilaria vermiculophylla HapMaleFtJ_2017 male (Gracilaria vermiculophylla HapMaleFtJ_2017 male)
Sequence length	175

Homology

The following BLAST results are available for this feature:

BLAST of Gvermi4313.t1 vs. uniprot

BLAST of Gvermi4313.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	COILS	Coil	Coil	coord: 2..31
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..30
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 68..104
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 68..97
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 153..174

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
ScGOVlb_147	contig	ScGOVlb_147:1183360..1183884 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria vermiculophylla HapMaleFtJ_2017 male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Gvermi4313.t1	Gvermi4313.t1	Gracilaria vermiculophylla HapMaleFtJ_2017 male	mRNA	ScGOVlb_147 1183360..1183884 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Gvermi4313.t1 ID=Gvermi4313.t1|Name=Gvermi4313.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=polypeptide|length=175bp
MAAKKRDERQKTAERKRKEKEESRKKKLAEKLLGEDQNCLQKCLKPLESI
CAAERKVVPQCKAKPRLSDCTPPRKTFRDGLKDAASQARHDESQSIEDGG
SANDAAKALLEMHHMSLRLLETHELIFEDLVADQSCIEEPGYKTFKLIKK
KESVPNYPSAPSRGDAEALVKLTP*