Gvermi11974.t1 (mRNA) Gracilaria vermiculophylla HapMaleFtJ_2017 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gvermi11974.t1 ID=Gvermi11974.t1|Name=Gvermi11974.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=mRNA|length=228bpback to top spliced messenger RNA >Gvermi11974.t1 ID=Gvermi11974.t1|Name=Gvermi11974.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=mRNA|length=684bp|location=Sequence derived from alignment at ScGOVlb_3404:2774587..2775270- (Gracilaria vermiculophylla HapMaleFtJ_2017 male)|Notes=Excludes all bases but those of type(s): exon. ATGTGCGCGTGCGAGCTTTCTGAAAATGAAGCCACCTCGTCTGACGAACAback to top protein sequence of Gvermi11974.t1 >Gvermi11974.t1 ID=Gvermi11974.t1|Name=Gvermi11974.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=polypeptide|length=228bp MCACELSENEATSSDEQVVTDAAESLATLMKTDEVQPEDVSRALDSLSRLback to top mRNA from alignment at ScGOVlb_3404:2774587..2775270- Legend: polypeptideCDSexonstart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gvermi11974.t1 ID=Gvermi11974.t1|Name=Gvermi11974.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=mRNA|length=684bp|location=Sequence derived from alignment at ScGOVlb_3404:2774587..2775270- (Gracilaria vermiculophylla HapMaleFtJ_2017 male)back to top Coding sequence (CDS) from alignment at ScGOVlb_3404:2774587..2775270- >Gvermi11974.t1 ID=Gvermi11974.t1|Name=Gvermi11974.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=CDS|length=684bp|location=Sequence derived from alignment at ScGOVlb_3404:2774587..2775270- (Gracilaria vermiculophylla HapMaleFtJ_2017 male)back to top |