Ggra10705.t1 (mRNA) Gracilaria gracilis GNS1m male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ggra10705.t1 ID=Ggra10705.t1|Name=Ggra10705.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=161bpback to top spliced messenger RNA >Ggra10705.t1 ID=Ggra10705.t1|Name=Ggra10705.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=483bp|location=Sequence derived from alignment at tig00000888_pilon:553008..553490- (Gracilaria gracilis GNS1m male)|Notes=Excludes all bases but those of type(s): exon. ATGAAGAACCTTCTCATTCTCACTTTGTGCTTCGCTCTATCCTATGCTACback to top protein sequence of Ggra10705.t1 >Ggra10705.t1 ID=Ggra10705.t1|Name=Ggra10705.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=161bp MKNLLILTLCFALSYATVVPTSDTTGKTHETVKTKLADSPLPTANKVLDHback to top mRNA from alignment at tig00000888_pilon:553008..553490- Legend: polypeptideCDSexonstart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Ggra10705.t1 ID=Ggra10705.t1|Name=Ggra10705.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=483bp|location=Sequence derived from alignment at tig00000888_pilon:553008..553490- (Gracilaria gracilis GNS1m male)back to top Coding sequence (CDS) from alignment at tig00000888_pilon:553008..553490- >Ggra10705.t1 ID=Ggra10705.t1|Name=Ggra10705.t1|organism=Gracilaria gracilis GNS1m male|type=CDS|length=483bp|location=Sequence derived from alignment at tig00000888_pilon:553008..553490- (Gracilaria gracilis GNS1m male)back to top |