Ggra9649.t1 (polypeptide) Gracilaria gracilis GNS1m male
Overview
Homology
BLAST of Ggra9649.t1 vs. uniprot
Match: A0A371D1H6 (Uncharacterized protein n=1 Tax=Polyporus brumalis TaxID=139420 RepID=A0A371D1H6_9APHY) HSP 1 Score: 62.4 bits (150), Expect = 1.590e-7 Identity = 28/92 (30.43%), Postives = 47/92 (51.09%), Query Frame = 0 Query: 45 GTEKYTLEDVNHMLDLVAQYKPINNNQWAQIASKYATYARLKCRPRRTINSLKYTFDQLLFTPNHIADLSCPPQVRRAKQINNMVLGGLHVQ 136 G++ Y+ ED+ +LDL + PI N W Q+ ++ +A RP RT LK F+ ++ TP + PP + RA I + + +H + Sbjct: 135 GSQNYSEEDLESLLDLTQEILPIGQNAWGQVTRRFNEWAEQNGRPPRTQKPLKTKFETMVRTPKPTGNAEIPPHIERAYDIEHSINEKVHTR 226
BLAST of Ggra9649.t1 vs. uniprot
Match: A0A8H6ZBD8 (Uncharacterized protein n=1 Tax=Mycena venus TaxID=2733690 RepID=A0A8H6ZBD8_9AGAR) HSP 1 Score: 58.5 bits (140), Expect = 2.930e-6 Identity = 23/88 (26.14%), Postives = 48/88 (54.55%), Query Frame = 0 Query: 42 KHRGTEKYTLEDVNHMLDLVAQYKPINNNQWAQIASKYATYARLKCRPRRTINSLKYTFDQLLFTPNHIADLSCPPQVRRAKQINNMV 129 + +G++ ++ D+ +LDLV ++ P+ W + + +A RP+R +++ + LL T D CPP+++RA QI +++ Sbjct: 185 RRKGSQNWSKNDMGKLLDLVQKHLPLGQKGWKLVTDDFCKWAERSGRPQRDGKAIEAKYKTLLKTKKPTGDAHCPPEIKRAHQIESLI 272
BLAST of Ggra9649.t1 vs. uniprot
Match: uncharacterized protein n=3 Tax=Suillus clintonianus TaxID=1904413 RepID=UPI001B86DC40 (uncharacterized protein n=3 Tax=Suillus clintonianus TaxID=1904413 RepID=UPI001B86DC40) HSP 1 Score: 57.8 bits (138), Expect = 4.300e-6 Identity = 30/85 (35.29%), Postives = 44/85 (51.76%), Query Frame = 0 Query: 45 GTEKYTLEDVNHMLDLVAQYKPINNNQWAQIASKYATYARLKCRPRRTINSLKYTFDQLLFTPNHIADLSCPPQVRRAKQINNMV 129 G+ Y+ DV +LDLV +P+ W I KY+ +A RP R SL+ F QL+ T + CPP V RA +I+ ++ Sbjct: 82 GSNNYSAADVQVLLDLVEDERPLGQKGWQAIHLKYSEWATSHGRPPRKAMSLETKFKQLVKTTKPTGNGVCPPDVTRAHEIDALI 166 The following BLAST results are available for this feature:
BLAST of Ggra9649.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ggra9649.t1 ID=Ggra9649.t1|Name=Ggra9649.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=255bpback to top |