Ggra7751.t1 (polypeptide) Gracilaria gracilis GNS1m male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Ggra7751.t1
Unique Name	Ggra7751.t1
Type	polypeptide
Organism	Gracilaria gracilis GNS1m male (Gracilaria gracilis GNS1m male (Slender Wart Weed))
Sequence length	226

Homology

The following BLAST results are available for this feature:

BLAST of Ggra7751.t1 vs. uniprot

BLAST of Ggra7751.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..23
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 33..57
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 148..165
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 189..203
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 125..147
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..207
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 104..118
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 84..98

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
tig00000088_pilon	contig	tig00000088_pilon:329432..330109 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria gracilis GNS1m male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Ggra7751.t1	Ggra7751.t1	Gracilaria gracilis GNS1m male	mRNA	tig00000088_pilon 329432..330109 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Ggra7751.t1 ID=Ggra7751.t1|Name=Ggra7751.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=226bp
MSSSSGYTPPSSRYSQRSFDSDCTPPSSPPPSLSSAASRAPSSASSRSSQ
PSTHPLLAAGVFTTLLAARHVRSFLQRRRTPLHTPSYEPPPKQPPARSAS
PLTPAAAPAPPPPPARTASPLARAAAPAPPSPHSAAPSPPPSRRSSSGSS
PPPSRRSSSGSSPPHARARIKQVRRRVFARVQSHLRDQAPAPSERSSAPS
RRTRLSHWARAKKSAGLADLFHLQH*