|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR013087 | Zinc finger C2H2-type | SMART | SM00355 | c2h2final6 | coord: 199..222
e-value: 0.082
score: 22.0
coord: 141..164
e-value: 0.027
score: 23.6
coord: 257..280
e-value: 0.0022
score: 27.3
coord: 228..251
e-value: 0.045
score: 22.9
coord: 170..193
e-value: 0.29
score: 20.2 |
| IPR013087 | Zinc finger C2H2-type | PFAM | PF00096 | zf-C2H2 | coord: 141..164
e-value: 0.007
score: 16.8
coord: 257..280
e-value: 0.0052
score: 17.2 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 259..280 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 230..251 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 143..164 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 201..222 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 172..193 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 141..169
score: 12.7362 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 199..227
score: 14.357281 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 228..256
score: 11.800961 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 257..280
score: 11.322948 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 170..198
score: 10.117529 |
| None | No IPR available | GENE3D | 3.30.160.60 | Classic Zinc Finger | coord: 165..194
e-value: 2.1E-5
score: 26.2
coord: 251..280
e-value: 1.7E-7
score: 32.8 |
| None | No IPR available | GENE3D | 3.30.160.60 | Classic Zinc Finger | coord: 195..226
e-value: 4.7E-5
score: 25.1 |
| None | No IPR available | GENE3D | 3.30.160.60 | Classic Zinc Finger | coord: 139..164
e-value: 2.2E-8
score: 35.9 |
| None | No IPR available | GENE3D | 3.30.160.60 | Classic Zinc Finger | coord: 227..250
e-value: 3.2E-6
score: 28.9 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 76..125 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 1..44 |
| None | No IPR available | PANTHER | PTHR24376 | ZINC FINGER PROTEIN | coord: 138..280 |
| None | No IPR available | PANTHER | PTHR24376:SF138 | OOCYTE ZINC FINGER PROTEIN XLCOF6-LIKE | coord: 138..280 |
| None | No IPR available | PANTHER | PTHR24376:SF138 | OOCYTE ZINC FINGER PROTEIN XLCOF6-LIKE | coord: 136..219 |
| None | No IPR available | PANTHER | PTHR24376 | ZINC FINGER PROTEIN | coord: 136..219 |
| IPR036236 | Zinc finger C2H2 superfamily | SUPERFAMILY | 57667 | beta-beta-alpha zinc fingers | coord: 197..231 |
| IPR036236 | Zinc finger C2H2 superfamily | SUPERFAMILY | 57667 | beta-beta-alpha zinc fingers | coord: 139..191 |
| IPR036236 | Zinc finger C2H2 superfamily | SUPERFAMILY | 57667 | beta-beta-alpha zinc fingers | coord: 222..275 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ggra2104.t1 ID=Ggra2104.t1|Name=Ggra2104.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=291bp
MAAVTSPSPAAPHSTLPPLKRPFGAHAVDALPPSPPPAKRPRNYWDVVLD
VAAVSAHHPPPVVRALPPLPPLFPARADQRLAASHAPPPHSPHSPHLPFE
SSPLSQPPASSAVAQPPPLPALRAALPDAARVRAVQPAKPFPCTSCPSTF
ARANHLRLHVRTIHEKAKPFACEQCPATFGHVSSKYRHFRTVHLKRRDFA
CDRCGQTFAERSAVFKHCRTVHEGSRPYPCHICGFRFHFKLHLTQHIATV
HEKQRPHQCTVCGACFGQRSSLNRHSRQIHGLVTKRVTPS* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|