Ggra3391.t1 (mRNA) Gracilaria gracilis GNS1m male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ggra3391.t1 ID=Ggra3391.t1|Name=Ggra3391.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=167bpback to top spliced messenger RNA >Ggra3391.t1 ID=Ggra3391.t1|Name=Ggra3391.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=499bp|location=Sequence derived from alignment at tig00000905_pilon:2..500+ (Gracilaria gracilis GNS1m male)|Notes=Excludes all bases but those of type(s): exon. TGGTATTGAATGTCATCATGAAGACCTGGTTCATGAGACGAGTGAAGAATback to top protein sequence of Ggra3391.t1 >Ggra3391.t1 ID=Ggra3391.t1|Name=Ggra3391.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=167bp XGIECHHEDLVHETSEESLEDEGWRGLKSSLENWCRTFIGFLMLVAAGQRback to top mRNA from alignment at tig00000905_pilon:2..500+ Legend: CDSpolypeptideexonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Ggra3391.t1 ID=Ggra3391.t1|Name=Ggra3391.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=499bp|location=Sequence derived from alignment at tig00000905_pilon:2..500+ (Gracilaria gracilis GNS1m male)back to top Coding sequence (CDS) from alignment at tig00000905_pilon:2..500+ >Ggra3391.t1 ID=Ggra3391.t1|Name=Ggra3391.t1|organism=Gracilaria gracilis GNS1m male|type=CDS|length=499bp|location=Sequence derived from alignment at tig00000905_pilon:2..500+ (Gracilaria gracilis GNS1m male)back to top |