Ggra3039.t2 (mRNA) Gracilaria gracilis GNS1m male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ggra3039.t2 ID=Ggra3039.t2|Name=Ggra3039.t2|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=140bpback to top spliced messenger RNA >Ggra3039.t2 ID=Ggra3039.t2|Name=Ggra3039.t2|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=420bp|location=Sequence derived from alignment at tig00000858_pilon:1023106..1023525- (Gracilaria gracilis GNS1m male)|Notes=Excludes all bases but those of type(s): exon. ATGAGCAGCGATAGCGACATGGAGAATGTGGATAAGATAGTGAAGATACTback to top protein sequence of Ggra3039.t2 >Ggra3039.t2 ID=Ggra3039.t2|Name=Ggra3039.t2|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=140bp MSSDSDMENVDKIVKILEKEGIEHKQIYANEDIEAFAEELYAWMSDTAGDback to top mRNA from alignment at tig00000858_pilon:1023106..1023525- Legend: polypeptideCDSexonstart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Ggra3039.t2 ID=Ggra3039.t2|Name=Ggra3039.t2|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=420bp|location=Sequence derived from alignment at tig00000858_pilon:1023106..1023525- (Gracilaria gracilis GNS1m male)back to top Coding sequence (CDS) from alignment at tig00000858_pilon:1023106..1023525- >Ggra3039.t2 ID=Ggra3039.t2|Name=Ggra3039.t2|organism=Gracilaria gracilis GNS1m male|type=CDS|length=420bp|location=Sequence derived from alignment at tig00000858_pilon:1023106..1023525- (Gracilaria gracilis GNS1m male)back to top |