Ggra153.t1 (mRNA) Gracilaria gracilis GNS1m male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ggra153.t1 ID=Ggra153.t1|Name=Ggra153.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=50bpback to top spliced messenger RNA >Ggra153.t1 ID=Ggra153.t1|Name=Ggra153.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=148bp|location=Sequence derived from alignment at tig00000854_pilon:46..530+ (Gracilaria gracilis GNS1m male)|Notes=Excludes all bases but those of type(s): exon. aatcgtggatgATTTCGGAGGTGCTTTTGCAATGGGTGCAATTGgcggtgback to top protein sequence of Ggra153.t1 >Ggra153.t1 ID=Ggra153.t1|Name=Ggra153.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=50bp XIVDDFGGAFAMGAIGGGSFAVWGGLFSSFDFVLACALQERTLLWEGFS*back to top mRNA from alignment at tig00000854_pilon:46..530+ Legend: polypeptideCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Ggra153.t1 ID=Ggra153.t1|Name=Ggra153.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=485bp|location=Sequence derived from alignment at tig00000854_pilon:46..530+ (Gracilaria gracilis GNS1m male)back to top Coding sequence (CDS) from alignment at tig00000854_pilon:46..530+ >Ggra153.t1 ID=Ggra153.t1|Name=Ggra153.t1|organism=Gracilaria gracilis GNS1m male|type=CDS|length=148bp|location=Sequence derived from alignment at tig00000854_pilon:46..530+ (Gracilaria gracilis GNS1m male)back to top |