Gchil9564.t1 (polypeptide) Gracilaria chilensis NLEC103_M9 male
Overview
Homology
BLAST of Gchil9564.t1 vs. uniprot
Match: A0A2V3J2T4_9FLOR (PRKR-interacting protein 1-like n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3J2T4_9FLOR) HSP 1 Score: 57.0 bits (136), Expect = 5.310e-7 Identity = 32/61 (52.46%), Postives = 39/61 (63.93%), Query Frame = 0 Query: 77 RNVVPKNVSGSTAGASSGDFHVYRHQRRRELERVQNMLKLAEQADADLRLSRAAEQRSAKE 137 R+ KNVS S AGASSGDFH YRHQRRREL+R++ + K A RA +R +KE Sbjct: 16 RSEEAKNVSSSIAGASSGDFHSYRHQRRRELDRIEQLEKEATDRRGLEDQQRAERERYSKE 76
BLAST of Gchil9564.t1 vs. uniprot
Match: A0A6A6WI07_9PEZI (DUF1168-domain-containing protein n=1 Tax=Pseudovirgaria hyperparasitica TaxID=470096 RepID=A0A6A6WI07_9PEZI) HSP 1 Score: 56.2 bits (134), Expect = 2.100e-6 Identity = 28/66 (42.42%), Postives = 41/66 (62.12%), Query Frame = 0 Query: 76 PRNVVPKNVSGSTAGASSGDFHVYRHQRRRELERVQNMLKLAEQADADLRLSRAAEQRSAKEIAQT 141 P + NV GS+AGA SG+FHVY+ RRRE ER++ M + + DL R E+R+ ++ A+T Sbjct: 62 PPPEIVANVQGSSAGAGSGEFHVYKASRRREYERIRTMEEEVRKTQEDLDFQRTREERAKQDAAKT 127
BLAST of Gchil9564.t1 vs. uniprot
Match: A0A0D6EIJ8_SPOSA (SPOSA6832_01404-mRNA-1:cds (Fragment) n=1 Tax=Sporidiobolus salmonicolor TaxID=5005 RepID=A0A0D6EIJ8_SPOSA) HSP 1 Score: 56.2 bits (134), Expect = 2.700e-6 Identity = 32/60 (53.33%), Postives = 42/60 (70.00%), Query Frame = 0 Query: 76 PRNVVPKNVSGSTAGASSGDFHVYRHQRRRELERVQNMLKLAEQADADLRLSRAAEQRSA 135 PR ++ KNV GS+AGA SG+FHVY+ RRRE ER LKL ++ +A L+ R AE+R A Sbjct: 63 PREMM-KNVQGSSAGAGSGEFHVYKQSRRREYER----LKLMDEEEAFLKAKREAEERQA 117
BLAST of Gchil9564.t1 vs. uniprot
Match: A0A6G1FVI1_9PEZI (DUF1168-domain-containing protein n=1 Tax=Eremomyces bilateralis CBS 781.70 TaxID=1392243 RepID=A0A6G1FVI1_9PEZI) HSP 1 Score: 55.5 bits (132), Expect = 3.630e-6 Identity = 30/74 (40.54%), Postives = 44/74 (59.46%), Query Frame = 0 Query: 75 DPRNVVPK-----NVSGSTAGASSGDFHVYRHQRRRELERVQNMLKLAEQADADLRLSRAAEQRSAKEIAQTAR 143 DP+ + P NV GS+AGA SG+FHVY+ RRRE +R++ M + EQ AD + E++ + A+T R Sbjct: 54 DPKKLAPPPEIVANVQGSSAGAGSGEFHVYKASRRREYDRLRQMDESVEQEQADKEFAARKEEQKRXDXAKTNR 127
BLAST of Gchil9564.t1 vs. uniprot
Match: L8GQK7_ACACA (Uncharacterized protein n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8GQK7_ACACA) HSP 1 Score: 54.3 bits (129), Expect = 5.090e-6 Identity = 33/74 (44.59%), Postives = 43/74 (58.11%), Query Frame = 0 Query: 70 AACDTDPRNVVPKNVSGSTAGASSGDFHVYRHQRRRELERVQNMLKLAEQADADLRLSRAAEQRSAKEIAQTAR 143 A T +N V KNVSGSTAGA SGDFH YR RR EL R++ + K A + + + R E+ K +TA+ Sbjct: 6 APARTVEKNTV-KNVSGSTAGAGSGDFHQYRSMRRHELFRLEQLEKEAAKREQEEEFQRKREENLRKAXXKTAK 78
BLAST of Gchil9564.t1 vs. uniprot
Match: A0A0C2ZU05_9AGAM (Uncharacterized protein n=1 Tax=Scleroderma citrinum Foug A TaxID=1036808 RepID=A0A0C2ZU05_9AGAM) HSP 1 Score: 55.1 bits (131), Expect = 5.970e-6 Identity = 33/73 (45.21%), Postives = 43/73 (58.90%), Query Frame = 0 Query: 76 PRNVVPKNVSGSTAGASSGDFHVYRHQRRRELERVQNMLKL----AEQADADLRLSRAAEQRSAKEIAQTARR 144 P + KNV GS+AGA SG+FHVY+ RRRE ER++ M +L AE AD + R A EQ +K +R Sbjct: 59 PAREMMKNVQGSSAGAGSGEFHVYKASRRREYERLKIMEELSRKEAETADFERRRKEAVEQAESKTAKNRVKR 131
BLAST of Gchil9564.t1 vs. uniprot
Match: UPI00106AA58B (PRKR-interacting protein 1 homolog n=1 Tax=Dendronephthya gigantea TaxID=151771 RepID=UPI00106AA58B) HSP 1 Score: 53.1 bits (126), Expect = 8.360e-6 Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 0 Query: 74 TDPRNVVPKNVSGSTAGASSGDFHVYRHQRRRELERVQNMLKLAEQADADLRLSRAAEQRSAKEIAQTARR 144 +DP++ V + V GS+AGA SG+FHVYR RRRE R++ + A++ DAD R E+ AK +TA++ Sbjct: 54 SDPKDFV-RFVMGSSAGAGSGEFHVYRATRRRENNRLKYIDDKAKKEDADSEYQRKQEENEAKAEERTAKK 123
BLAST of Gchil9564.t1 vs. uniprot
Match: D3BSH2_POLPP (Uncharacterized protein n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3BSH2_POLPP) HSP 1 Score: 53.1 bits (126), Expect = 8.510e-6 Identity = 24/37 (64.86%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 79 VVPKNVSGSTAGASSGDFHVYRHQRRRELERVQNMLK 115 V+ NVSGSTAG+ SGDFHVYR+QRR+EL R++ + K Sbjct: 23 VIVSNVSGSTAGSGSGDFHVYRNQRRKELTRLEKLEK 59 The following BLAST results are available for this feature:
BLAST of Gchil9564.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 8
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Gchil9564.t1 ID=Gchil9564.t1|Name=Gchil9564.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=polypeptide|length=182bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|