Gchil9343.t1 (polypeptide) Gracilaria chilensis NLEC103_M9 male
Overview
Homology
BLAST of Gchil9343.t1 vs. uniprot
Match: A0A2V3IEM2_9FLOR (Uncharacterized protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IEM2_9FLOR) HSP 1 Score: 64.3 bits (155), Expect = 3.590e-11 Identity = 32/47 (68.09%), Postives = 36/47 (76.60%), Query Frame = 0 Query: 43 REDRPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIVPLAQQLL 89 R+DR A GFT YAER+NGRAAMLG VA V IEL GRG+V L + LL Sbjct: 70 RDDRRAMGFTTYAERVNGRAAMLGLVAAVAIELVAGRGLVALLEALL 116
BLAST of Gchil9343.t1 vs. uniprot
Match: UPI0018EFA535 (chlorophyll a/b-binding protein n=2 Tax=Phormidium sp. FACHB-1136 TaxID=2692848 RepID=UPI0018EFA535) HSP 1 Score: 56.2 bits (134), Expect = 1.140e-8 Identity = 28/38 (73.68%), Postives = 30/38 (78.95%), Query Frame = 0 Query: 45 DRPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIV 82 DRP GF YAER+NGRAAMLGFVA VL ELA G+ IV Sbjct: 12 DRPKSGFNDYAERINGRAAMLGFVALVLFELATGQAIV 49
BLAST of Gchil9343.t1 vs. uniprot
Match: A0A8J7A9Z9_9CYAN (Uncharacterized protein n=1 Tax=Romeria aff. gracilis LEGE 07310 TaxID=915328 RepID=A0A8J7A9Z9_9CYAN) HSP 1 Score: 54.3 bits (129), Expect = 6.670e-8 Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 0 Query: 45 DRPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIV 82 DRP GFT YAERLNGRAAM+GFVA + IE GRG++ Sbjct: 13 DRPKTGFTEYAERLNGRAAMVGFVALLAIEYFTGRGLL 50
BLAST of Gchil9343.t1 vs. uniprot
Match: B4WSG6_SYNS7 (Uncharacterized protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=B4WSG6_SYNS7) HSP 1 Score: 54.3 bits (129), Expect = 6.670e-8 Identity = 26/39 (66.67%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 46 RPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIVPL 84 RP GF YAE+LNGRAAM+GFVA VLIEL G+G++ L Sbjct: 14 RPKKGFNEYAEQLNGRAAMVGFVALVLIELITGKGLLTL 52
BLAST of Gchil9343.t1 vs. uniprot
Match: A0A7T5E5Q1_9CYAN (Uncharacterized protein n=2 Tax=Leptolyngbya sp. BL0902 TaxID=1115757 RepID=A0A7T5E5Q1_9CYAN) HSP 1 Score: 54.7 bits (130), Expect = 8.500e-8 Identity = 27/38 (71.05%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 45 DRPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIV 82 DRP GF YAER+NGRAAMLGFVA VL EL G+ IV Sbjct: 38 DRPKSGFNDYAERINGRAAMLGFVALVLFELVTGQAIV 75
BLAST of Gchil9343.t1 vs. uniprot
Match: A0A0C1YCV3_9CYAN (CAB/ELIP/HLIP family protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A0C1YCV3_9CYAN) HSP 1 Score: 53.1 bits (126), Expect = 1.900e-7 Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 0 Query: 46 RPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIV 82 RP GFT YAE+LNGRAAM+GFVA V IE G+GI+ Sbjct: 14 RPKAGFTTYAEKLNGRAAMIGFVAIVAIEYLTGKGIM 50
BLAST of Gchil9343.t1 vs. uniprot
Match: UPI001683BB08 (hypothetical protein n=1 Tax=Pseudanabaena sp. FACHB-2040 TaxID=2692859 RepID=UPI001683BB08) HSP 1 Score: 53.1 bits (126), Expect = 1.900e-7 Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 0 Query: 46 RPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIV 82 RP GF YAERLNGRAAM+GFV VLIEL G+G++ Sbjct: 14 RPKAGFNDYAERLNGRAAMVGFVLVVLIELVTGKGVL 50
BLAST of Gchil9343.t1 vs. uniprot
Match: A0A2W6ZNR0_9CYAN (Uncharacterized protein n=13 Tax=Cyanobacteria/Melainabacteria group TaxID=1798711 RepID=A0A2W6ZNR0_9CYAN) HSP 1 Score: 52.4 bits (124), Expect = 3.800e-7 Identity = 27/38 (71.05%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 45 DRPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIV 82 +R GF YAERLNGRAAMLGFVA VL ELA G+ IV Sbjct: 13 ERSKAGFNDYAERLNGRAAMLGFVALVLFELATGQAIV 50
BLAST of Gchil9343.t1 vs. uniprot
Match: A0A6H2NL48_9CYAN (Uncharacterized protein n=2 Tax=Pseudanabaenales TaxID=2881377 RepID=A0A6H2NL48_9CYAN) HSP 1 Score: 52.0 bits (123), Expect = 5.390e-7 Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 0 Query: 46 RPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIV 82 RP GF YAERLNGRAAM+GF+ VLIEL G+G++ Sbjct: 14 RPKVGFNHYAERLNGRAAMIGFITIVLIELLTGQGVL 50
BLAST of Gchil9343.t1 vs. uniprot
Match: UPI00030F9F44 (chlorophyll a/b-binding protein n=1 Tax=Nodosilinea nodulosa TaxID=416001 RepID=UPI00030F9F44) HSP 1 Score: 52.0 bits (123), Expect = 5.390e-7 Identity = 26/38 (68.42%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 45 DRPAPGFTVYAERLNGRAAMLGFVATVLIELAGGRGIV 82 +RP GF YAERLNGRAAMLGFVA VL E G+ IV Sbjct: 13 ERPKSGFNDYAERLNGRAAMLGFVALVLFEAVTGQAIV 50 The following BLAST results are available for this feature:
BLAST of Gchil9343.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Gchil9343.t1 ID=Gchil9343.t1|Name=Gchil9343.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=polypeptide|length=99bpback to top |