Gchil7087.t1 (polypeptide) Gracilaria chilensis NLEC103_M9 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Gchil7087.t1
Unique Name	Gchil7087.t1
Type	polypeptide
Organism	Gracilaria chilensis NLEC103_M9 male (Gracilaria chilensis NLEC103_M9 male)
Sequence length	249

Homology

[Close]

BLAST of Gchil7087.t1 vs. uniprot
Match: R7QR26_CHOCR (Uncharacterized protein n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7QR26_CHOCR)

HSP 1 Score: 205 bits (522), Expect = 9.840e-63
Identity = 118/236 (50.00%), Postives = 153/236 (64.83%), Query Frame = 0

Query:    6 RLTLWREGGLQRVFAGAACGFVGGASYAYFTRLPP---VRAGVACAMLATPFFTVREVVAASMAVDGPVASAMTGGVAGYFGALVTLGPCWKSISRSAMLMGVGCGFVDILLSGLDWKRKLYLVNRHDAAVAAAAENVNTPHQHPHQPPQLHQPPQPAPSAPFKWPHWFPVVKQIDDEYEELLRRQRATVQALEQEQARIALLLEALESVKAGKQVTDLELADAGLRSPDKNPSQP 238
            R   WREGGL+RV  G   GF GGA YA    LPP   +R G+ C +   PFF  REV+ A + +DGP+AS + GG+AGY G+L   GP WK++S SAM +G+GCGF DI++S LDW+RK+Y+VNRHDAAV AAAE V +         +     Q + S  FK P W P +  ID+EY++LLRRQ ATV ALE+EQARIA+LLEAL+ VK+  ++ + E A   L +   NP  P
Sbjct:   10 RSAWWREGGLRRVSLGGLTGFAGGALYATARALPPAYALRGGLVCGVFTAPFFAFREVLTARLHMDGPMASTIAGGIAGYVGSLFIAGPHWKTVSHSAMAVGIGCGFADIVVSRLDWQRKVYIVNRHDAAVKAAAEQVESK--------ESGASVQRSNSF-FKLPSWLPGLNDIDNEYQDLLRRQEATVVALEKEQARIAVLLEALDRVKSATEIINPEKARPDLPA-SVNPQAP 235

The following BLAST results are available for this feature:

BLAST of Gchil7087.t1 vs. uniprot

BLAST of Gchil7087.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
R7QR26_CHOCR	9.840e-63	50.00	Uncharacterized protein n=1 Tax=Chondrus crispus T...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	COILS	Coil	Coil	coord: 178..212
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 216..248
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 136..161
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 58..68
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 41..57
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 120..248
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 101..119
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 1..14
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 69..89
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 90..100
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 36..40
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 15..35
None	No IPR available	TMHMM	TMhelix		coord: 71..93
None	No IPR available	TMHMM	TMhelix		coord: 13..35

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
tig00000131_pilon	contig	tig00000131_pilon:553455..554201 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria chilensis NLEC103_M9 male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Gchil7087.t1	Gchil7087.t1	Gracilaria chilensis NLEC103_M9 male	mRNA	tig00000131_pilon 553455..554201 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Gchil7087.t1 ID=Gchil7087.t1|Name=Gchil7087.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=polypeptide|length=249bp
MSAQKRLTLWREGGLQRVFAGAACGFVGGASYAYFTRLPPVRAGVACAML
ATPFFTVREVVAASMAVDGPVASAMTGGVAGYFGALVTLGPCWKSISRSA
MLMGVGCGFVDILLSGLDWKRKLYLVNRHDAAVAAAAENVNTPHQHPHQP
PQLHQPPQPAPSAPFKWPHWFPVVKQIDDEYEELLRRQRATVQALEQEQA
RIALLLEALESVKAGKQVTDLELADAGLRSPDKNPSQPPLSSPSIPAP*