Gchil2659.t2 (mRNA) Gracilaria chilensis NLEC103_M9 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gchil2659.t2 ID=Gchil2659.t2|Name=Gchil2659.t2|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=127bpback to top spliced messenger RNA >Gchil2659.t2 ID=Gchil2659.t2|Name=Gchil2659.t2|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=381bp|location=Sequence derived from alignment at tig00004400_pilon:2227579..2228079- (Gracilaria chilensis NLEC103_M9 male)|Notes=Excludes all bases but those of type(s): exon. ATGGGGCACCATTCGTGCCATCAAATTGAACAAGATGGGCACAATGCATTback to top protein sequence of Gchil2659.t2 >Gchil2659.t2 ID=Gchil2659.t2|Name=Gchil2659.t2|organism=Gracilaria chilensis NLEC103_M9 male|type=polypeptide|length=127bp MGHHSCHQIEQDGHNALLRKETYGRDRWVEYVDDRNPDSSKITSEWHAWLback to top mRNA from alignment at tig00004400_pilon:2227579..2228079- Legend: polypeptideCDSexonstart_codonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gchil2659.t2 ID=Gchil2659.t2|Name=Gchil2659.t2|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=501bp|location=Sequence derived from alignment at tig00004400_pilon:2227579..2228079- (Gracilaria chilensis NLEC103_M9 male)back to top Coding sequence (CDS) from alignment at tig00004400_pilon:2227579..2228079- >Gchil2659.t2 ID=Gchil2659.t2|Name=Gchil2659.t2|organism=Gracilaria chilensis NLEC103_M9 male|type=CDS|length=381bp|location=Sequence derived from alignment at tig00004400_pilon:2227579..2228079- (Gracilaria chilensis NLEC103_M9 male)back to top |