Gchil10029.t1 (mRNA) Gracilaria chilensis NLEC103_M9 male
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gchil10029.t1 ID=Gchil10029.t1|Name=Gchil10029.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=88bpback to top spliced messenger RNA >Gchil10029.t1 ID=Gchil10029.t1|Name=Gchil10029.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=264bp|location=Sequence derived from alignment at tig00004442_pilon:465129..465479- (Gracilaria chilensis NLEC103_M9 male)|Notes=Excludes all bases but those of type(s): exon. ATGGTGGGCGGAATGGGTGTTCGGAAGAATGTTCACATTGAAGAATGGGCback to top protein sequence of Gchil10029.t1 >Gchil10029.t1 ID=Gchil10029.t1|Name=Gchil10029.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=polypeptide|length=88bp MVGGMGVRKNVHIEEWASFRENCEHAFKFSRANWARLAVFGFAVPIGLYVback to top mRNA from alignment at tig00004442_pilon:465129..465479- Legend: polypeptideCDSexonstart_codonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gchil10029.t1 ID=Gchil10029.t1|Name=Gchil10029.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=351bp|location=Sequence derived from alignment at tig00004442_pilon:465129..465479- (Gracilaria chilensis NLEC103_M9 male)back to top Coding sequence (CDS) from alignment at tig00004442_pilon:465129..465479- >Gchil10029.t1 ID=Gchil10029.t1|Name=Gchil10029.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=CDS|length=264bp|location=Sequence derived from alignment at tig00004442_pilon:465129..465479- (Gracilaria chilensis NLEC103_M9 male)back to top |