Gcaud1031.t1 (mRNA) Gracilaria caudata M_176_S67 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gcaud1031.t1 ID=Gcaud1031.t1|Name=Gcaud1031.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=142bpback to top spliced messenger RNA >Gcaud1031.t1 ID=Gcaud1031.t1|Name=Gcaud1031.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=426bp|location=Sequence derived from alignment at NODE_2077_length_6941_cov_4.766715:4060..4485+ (Gracilaria caudata M_176_S67 male)|Notes=Excludes all bases but those of type(s): exon. ATGGCCCCCTTGAAGGAGGTTGCCTCTGCACCCATTACTGGCCCCATGGAback to top protein sequence of Gcaud1031.t1 >Gcaud1031.t1 ID=Gcaud1031.t1|Name=Gcaud1031.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=142bp MAPLKEVASAPITGPMERGAKGVLKNSVPAIKVSKNSHGPLVPLGLQNSVback to top mRNA from alignment at NODE_2077_length_6941_cov_4.766715:4060..4485+ Legend: start_codonpolypeptideCDSexonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gcaud1031.t1 ID=Gcaud1031.t1|Name=Gcaud1031.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=426bp|location=Sequence derived from alignment at NODE_2077_length_6941_cov_4.766715:4060..4485+ (Gracilaria caudata M_176_S67 male)back to top Coding sequence (CDS) from alignment at NODE_2077_length_6941_cov_4.766715:4060..4485+ >Gcaud1031.t1 ID=Gcaud1031.t1|Name=Gcaud1031.t1|organism=Gracilaria caudata M_176_S67 male|type=CDS|length=426bp|location=Sequence derived from alignment at NODE_2077_length_6941_cov_4.766715:4060..4485+ (Gracilaria caudata M_176_S67 male)back to top |