Gcaud9503.t2 (mRNA) Gracilaria caudata M_176_S67 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gcaud9503.t2 ID=Gcaud9503.t2|Name=Gcaud9503.t2|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=134bpback to top spliced messenger RNA >Gcaud9503.t2 ID=Gcaud9503.t2|Name=Gcaud9503.t2|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=402bp|location=Sequence derived from alignment at NODE_69_length_56878_cov_4.412084:15675..16437+ (Gracilaria caudata M_176_S67 male)|Notes=Excludes all bases but those of type(s): exon. ATGGAGGGAAAGCTCAGCATTTGGATCAAGTCTGGTAGCTTCAATCATTAback to top protein sequence of Gcaud9503.t2 >Gcaud9503.t2 ID=Gcaud9503.t2|Name=Gcaud9503.t2|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=134bp MEGKLSIWIKSGSFNHYRDLYIQVLVDDNDIWRTDDKDGFSPNWDSTVVKback to top mRNA from alignment at NODE_69_length_56878_cov_4.412084:15675..16437+ Legend: polypeptidestart_codonCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gcaud9503.t2 ID=Gcaud9503.t2|Name=Gcaud9503.t2|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=763bp|location=Sequence derived from alignment at NODE_69_length_56878_cov_4.412084:15675..16437+ (Gracilaria caudata M_176_S67 male)back to top Coding sequence (CDS) from alignment at NODE_69_length_56878_cov_4.412084:15675..16437+ >Gcaud9503.t2 ID=Gcaud9503.t2|Name=Gcaud9503.t2|organism=Gracilaria caudata M_176_S67 male|type=CDS|length=402bp|location=Sequence derived from alignment at NODE_69_length_56878_cov_4.412084:15675..16437+ (Gracilaria caudata M_176_S67 male)back to top |