Gcaud9696.t1 (polypeptide) Gracilaria caudata M_176_S67 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Gcaud9696.t1
Unique Name	Gcaud9696.t1
Type	polypeptide
Organism	Gracilaria caudata M_176_S67 male (Gracilaria caudata M_176_S67 male)
Sequence length	340

Homology

[Close]

BLAST of Gcaud9696.t1 vs. uniprot
Match: A0A2V3J3P9_9FLOR (SAP domain-containing protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3J3P9_9FLOR)

HSP 1 Score: 98.6 bits (244), Expect = 9.150e-20
Identity = 126/364 (34.62%), Postives = 171/364 (46.98%), Query Frame = 0

Query:    1 MKLSKLRVPELRKRLKALGLDEKGNRPVLIKRLREALLVEQNAKGSREKQA----DPQFKDDEQPA---TAGENPADSKTQQP-----APDRNDSAEGRPSMERTYKRKLED---DIRPEDH--SPKRRYKANTNGHTSSSATQVTRQISSPPRRQYRSKKVADESGVQDKQQVDRAPPVQEQPSTRSEPAKRGEADSPTSPQDGKNGVKNLDKESIGVSVTTGRPSENGSSTRIAKAAEPKSTGNLQDTEDAASLERIRRRKERFGIVIKEAAGGDPTDEEAXXXXXXXXGTITVM-----SNSAKISKAAKQEHD----EAALRRRAEKFGMNGVKRGPTDTALPKDEVEKRLKRQKRFQSV 338
            MKLSK+RV +LRK LK  GLD+KG RP L+KRLR+A+   +N K S E+QA    +   K D QP    +  E   D K Q+P       DR++      +  RTY+RK +D       ++H    KR  + N+            R+ +S  +RQ+R                       E  S   E  +     +       + GVK+L +         G+P +   S     A     T N+Q+T D  + ER+RRR ERFG V K       ++   XXXXXXXX           S + K+ K+AK E D    EAA RRRA KFG+   KR  +D  L  DE+EKRLKRQ+RFQ+V
Sbjct:    1 MKLSKMRVADLRKELKRRGLDDKGTRPSLMKRLRDAM---ENDKKSTEEQAQNASNASIKHDAQPTEPNSTREYSDDRKKQRPNRLTDTEDRSNREHTEKAQNRTYERKGDDRXXXXXXDEHFDDDKRVLEENS------------RRNASHVKRQHREXXXXXXXXXXXXXXXXXXXXXXETRSNEPEAKQNKTTGTENESSTPERGVKDLTQN--------GKPGKASHSPSKVNA-----TCNIQNTRDTPTDERMRRRLERFGTVEKTETTDSLSEXXXXXXXXXXXXXXXXXXXAEESGANKMDKSAKSEADQHEVEAAKRRRALKFGLESKKRDFSDAGLSPDEIEKRLKRQRRFQNV 336

The following BLAST results are available for this feature:

BLAST of Gcaud9696.t1 vs. uniprot

BLAST of Gcaud9696.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
A0A2V3J3P9_9FLOR	9.150e-20	34.62	SAP domain-containing protein n=1 Tax=Gracilariops...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR003034	SAP domain	SMART	SM00513	sap_9	coord: 3..37 e-value: 6.9E-8 score: 42.2
IPR003034	SAP domain	PFAM	PF02037	SAP	coord: 3..37 e-value: 2.9E-10 score: 39.7
IPR003034	SAP domain	PROSITE	PS50800	SAP	coord: 3..37 score: 12.003644
IPR036361	SAP domain superfamily	GENE3D	1.10.720.30	SAP domain	coord: 1..52 e-value: 9.4E-8 score: 33.5
IPR036361	SAP domain superfamily	SUPERFAMILY	68906	SAP domain	coord: 2..39
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 37..241
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 317..333
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 37..56
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 115..138
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 66..80
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 308..339
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 199..234
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 84..113
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 140..154
None	No IPR available	PANTHER	PTHR46551	SAP DOMAIN-CONTAINING RIBONUCLEOPROTEIN	coord: 2..165 coord: 153..337

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
NODE_82_length_55453_cov_4.345977	contig	NODE_82_length_55453_cov_4.345977:22446..23465 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria caudata M_176_S67 male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Gcaud9696.t1	Gcaud9696.t1	Gracilaria caudata M_176_S67 male	mRNA	NODE_82_length_55453_cov_4.345977 22446..23465 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Gcaud9696.t1 ID=Gcaud9696.t1|Name=Gcaud9696.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=340bp
MKLSKLRVPELRKRLKALGLDEKGNRPVLIKRLREALLVEQNAKGSREKQ
ADPQFKDDEQPATAGENPADSKTQQPAPDRNDSAEGRPSMERTYKRKLED
DIRPEDHSPKRRYKANTNGHTSSSATQVTRQISSPPRRQYRSKKVADESG
VQDKQQVDRAPPVQEQPSTRSEPAKRGEADSPTSPQDGKNGVKNLDKESI
GVSVTTGRPSENGSSTRIAKAAEPKSTGNLQDTEDAASLERIRRRKERFG
IVIKEAAGGDPTDEEAVRRRRARFGTITVMSNSAKISKAAKQEHDEAALR
RRAEKFGMNGVKRGPTDTALPKDEVEKRLKRQKRFQSVS*

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR003034	SAP_dom
IPR036361	SAP_dom_sf