Gcaud6982.t1 (polypeptide) Gracilaria caudata M_176_S67 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Gcaud6982.t1
Unique Name	Gcaud6982.t1
Type	polypeptide
Organism	Gracilaria caudata M_176_S67 male (Gracilaria caudata M_176_S67 male)
Sequence length	164

Homology

The following BLAST results are available for this feature:

BLAST of Gcaud6982.t1 vs. uniprot

BLAST of Gcaud6982.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 65..163
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 116..140
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..31
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..25
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 65..108

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
NODE_442_length_25194_cov_4.712106	contig	NODE_442_length_25194_cov_4.712106:19789..20280 -

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria caudata M_176_S67 male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Gcaud6982.t1	Gcaud6982.t1	Gracilaria caudata M_176_S67 male	mRNA	NODE_442_length_25194_cov_4.712106 19789..20280 -

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Gcaud6982.t1 ID=Gcaud6982.t1|Name=Gcaud6982.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=164bp
MSSGSPEQTTIDTSDYDQVINSLEQDEANDGFRVVSKPVLDDFMRECAQL
ISQANLGVKRAQQFIQRNVTPPLLRSPSQKDNASIEPVSLRSKTPTLQPS
SLQEDDAPSEEISPTRVSDHPFSNKSTRPFDANKRPSTPTNIDTAEERRE
TQVHKPPGTMNAK*