Gcaud1373.t1 (mRNA) Gracilaria caudata M_176_S67 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gcaud1373.t1 ID=Gcaud1373.t1|Name=Gcaud1373.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=104bpback to top spliced messenger RNA >Gcaud1373.t1 ID=Gcaud1373.t1|Name=Gcaud1373.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=312bp|location=Sequence derived from alignment at NODE_1067_length_14310_cov_4.938111:9761..10163- (Gracilaria caudata M_176_S67 male)|Notes=Excludes all bases but those of type(s): exon. ATGAGCTCTACCATTGTTGAAAAGGGGGCTGGAATGCGTCTCATTAAGAAback to top protein sequence of Gcaud1373.t1 >Gcaud1373.t1 ID=Gcaud1373.t1|Name=Gcaud1373.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=104bp MSSTIVEKGAGMRLIKNADEETINKLGCRSWGTWGCEPSTFPWTYSDDEVback to top mRNA from alignment at NODE_1067_length_14310_cov_4.938111:9761..10163- Legend: polypeptideCDSexonstart_codonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gcaud1373.t1 ID=Gcaud1373.t1|Name=Gcaud1373.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=403bp|location=Sequence derived from alignment at NODE_1067_length_14310_cov_4.938111:9761..10163- (Gracilaria caudata M_176_S67 male)back to top Coding sequence (CDS) from alignment at NODE_1067_length_14310_cov_4.938111:9761..10163- >Gcaud1373.t1 ID=Gcaud1373.t1|Name=Gcaud1373.t1|organism=Gracilaria caudata M_176_S67 male|type=CDS|length=312bp|location=Sequence derived from alignment at NODE_1067_length_14310_cov_4.938111:9761..10163- (Gracilaria caudata M_176_S67 male)back to top |