Gcaud1369.t1 (mRNA) Gracilaria caudata M_176_S67 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gcaud1369.t1 ID=Gcaud1369.t1|Name=Gcaud1369.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=85bpback to top spliced messenger RNA >Gcaud1369.t1 ID=Gcaud1369.t1|Name=Gcaud1369.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=255bp|location=Sequence derived from alignment at NODE_1067_length_14310_cov_4.938111:859..1274+ (Gracilaria caudata M_176_S67 male)|Notes=Excludes all bases but those of type(s): exon. ATGTTGCCAGAGGCAGGGATTGCGGTCACGCACAAACAACAACAGCAATTback to top protein sequence of Gcaud1369.t1 >Gcaud1369.t1 ID=Gcaud1369.t1|Name=Gcaud1369.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=85bp MLPEAGIAVTHKQQQQFMYPYSNSLEVGSGSHQGVTMRSALWSMKRAHHRback to top mRNA from alignment at NODE_1067_length_14310_cov_4.938111:859..1274+ Legend: polypeptidestart_codonCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gcaud1369.t1 ID=Gcaud1369.t1|Name=Gcaud1369.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=416bp|location=Sequence derived from alignment at NODE_1067_length_14310_cov_4.938111:859..1274+ (Gracilaria caudata M_176_S67 male)back to top Coding sequence (CDS) from alignment at NODE_1067_length_14310_cov_4.938111:859..1274+ >Gcaud1369.t1 ID=Gcaud1369.t1|Name=Gcaud1369.t1|organism=Gracilaria caudata M_176_S67 male|type=CDS|length=255bp|location=Sequence derived from alignment at NODE_1067_length_14310_cov_4.938111:859..1274+ (Gracilaria caudata M_176_S67 male)back to top |