Gcaud10122.t1 (mRNA) Gracilaria caudata M_176_S67 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gcaud10122.t1 ID=Gcaud10122.t1|Name=Gcaud10122.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=39bpback to top spliced messenger RNA >Gcaud10122.t1 ID=Gcaud10122.t1|Name=Gcaud10122.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=115bp|location=Sequence derived from alignment at NODE_2122_length_6761_cov_5.181409:824..1014+ (Gracilaria caudata M_176_S67 male)|Notes=Excludes all bases but those of type(s): exon. AAGTGGGCCTCATGTTCCGAAGAAGAAACCCATTCGAGCCAAGATGAGCGback to top protein sequence of Gcaud10122.t1 >Gcaud10122.t1 ID=Gcaud10122.t1|Name=Gcaud10122.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=39bp XSGPHVPKKKPIRAKMSAVKSNAVNECISWLDSNSGKH*back to top mRNA from alignment at NODE_2122_length_6761_cov_5.181409:824..1014+ Legend: polypeptideCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gcaud10122.t1 ID=Gcaud10122.t1|Name=Gcaud10122.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=191bp|location=Sequence derived from alignment at NODE_2122_length_6761_cov_5.181409:824..1014+ (Gracilaria caudata M_176_S67 male)back to top Coding sequence (CDS) from alignment at NODE_2122_length_6761_cov_5.181409:824..1014+ >Gcaud10122.t1 ID=Gcaud10122.t1|Name=Gcaud10122.t1|organism=Gracilaria caudata M_176_S67 male|type=CDS|length=115bp|location=Sequence derived from alignment at NODE_2122_length_6761_cov_5.181409:824..1014+ (Gracilaria caudata M_176_S67 male)back to top |