mRNA_F-serratus_M_contig1059.581.1 (mRNA) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5KSF1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSF1_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 7.570e-13 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 51 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 102
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5KCP5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCP5_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 2.840e-12 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 49 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 100
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5JMH2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMH2_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 2.890e-12 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 115 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 166
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5JUS2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUS2_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 1.160e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 222 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 273
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5KN08_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KN08_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 1.250e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 49 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 100
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5JFG8_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFG8_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 1.940e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 396 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 447
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5K4U7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4U7_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 1.950e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 113 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 164
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5J8Y8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8Y8_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 1.990e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 392 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 443
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5KFN2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFN2_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 1.960e-10 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREE 200 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE Sbjct: 49 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEE 90
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5K214_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K214_9PHAE) HSP 1 Score: 63.9 bits (154), Expect = 2.550e-10 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 GLTFVCLSRAKRL DL++EPM+F+R+ LG T++ RL+EE RL LA T Sbjct: 46 GLTFVCLSRAKRLVDLIVEPMSFDRIGNLGNSSTMKGRLQEEVRLGELARTT 97 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_F-serratus_M_contig1059.581.1 >prot_F-serratus_M_contig1059.581.1 ID=prot_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=polypeptide|length=76bp MLLLPRPRGWLLGHYGLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLback to top mRNA from alignment at F-serratus_M_contig1059:106996..107623+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_F-serratus_M_contig1059.581.1 ID=mRNA_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=mRNA|length=628bp|location=Sequence derived from alignment at F-serratus_M_contig1059:106996..107623+ (Fucus serratus male)back to top Coding sequence (CDS) from alignment at F-serratus_M_contig1059:106996..107623+ >mRNA_F-serratus_M_contig1059.581.1 ID=mRNA_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=CDS|length=456bp|location=Sequence derived from alignment at F-serratus_M_contig1059:106996..107623+ (Fucus serratus male)back to top |