prot_F-serratus_M_contig995.21239.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig995.21239.1 vs. uniprot
Match: W2NLQ1_PHYPR (H15 domain-containing protein n=9 Tax=Phytophthora TaxID=4783 RepID=W2NLQ1_PHYPR) HSP 1 Score: 65.1 bits (157), Expect = 1.630e-9 Identity = 34/67 (50.75%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 1 MAIEAIKALKERNGSSIQAIKKHITASNPSLNFTPHQMRSALKKGVESGKFVKVKSSYKLSAEAKKP 67 + ++AIK LKERNGSS QAI K + N N+ H + AL+ GVE+GK +++K SYKLS E +KP Sbjct: 81 LIVDAIKELKERNGSSRQAIAKVV--ENKKDNYASHHLNKALRTGVEAGKLIQIKGSYKLSPELRKP 145
BLAST of mRNA_F-serratus_M_contig995.21239.1 vs. uniprot
Match: A0A2D4BWE3_PYTIN (E1 ubiquitin-activating enzyme n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BWE3_PYTIN) HSP 1 Score: 65.9 bits (159), Expect = 2.530e-9 Identity = 36/67 (53.73%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 1 MAIEAIKALKERNGSSIQAIKKHITASNPSLNFTPHQMRSALKKGVESGKFVKVKSSYKLSAEAKKP 67 + +EAIK LKERNGSS QAI KH++A NF H + AL+ VE+ K V+VK+SYKL+ KKP Sbjct: 1424 LIVEAIKELKERNGSSRQAIAKHVSAKK--ANFASHFLNKALRTAVENEKLVQVKASYKLAPSLKKP 1488
BLAST of mRNA_F-serratus_M_contig995.21239.1 vs. uniprot
Match: A0A225WVS4_9STRA (Histone H1 n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225WVS4_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 3.040e-9 Identity = 34/67 (50.75%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 1 MAIEAIKALKERNGSSIQAIKKHITASNPSLNFTPHQMRSALKKGVESGKFVKVKSSYKLSAEAKKP 67 + ++AIK LKER+GSS QAI K + A N+ H + AL+ GVE+GK +++K SYKLS E KKP Sbjct: 80 LVVDAIKELKERSGSSRQAIGKVVEAKKN--NYASHHLNKALRTGVEAGKLIQIKGSYKLSPELKKP 144
BLAST of mRNA_F-serratus_M_contig995.21239.1 vs. uniprot
Match: D0P4B9_PHYIT (Histone H1, putative n=2 Tax=Phytophthora infestans (strain T30-4) TaxID=403677 RepID=D0P4B9_PHYIT) HSP 1 Score: 64.3 bits (155), Expect = 3.200e-9 Identity = 33/67 (49.25%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 1 MAIEAIKALKERNGSSIQAIKKHITASNPSLNFTPHQMRSALKKGVESGKFVKVKSSYKLSAEAKKP 67 + ++AIK LKERNGSS QAI K + N N+ H + AL+ V++GKF+++K SYKLS E +KP Sbjct: 84 LIVDAIKELKERNGSSRQAISKIV--ENKKDNYASHHLNKALRTAVDAGKFIQIKGSYKLSPELRKP 148
BLAST of mRNA_F-serratus_M_contig995.21239.1 vs. uniprot
Match: A0A6A3F8I3_9STRA (H15 domain-containing protein n=4 Tax=Phytophthora TaxID=4783 RepID=A0A6A3F8I3_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 3.320e-9 Identity = 34/67 (50.75%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 1 MAIEAIKALKERNGSSIQAIKKHITASNPSLNFTPHQMRSALKKGVESGKFVKVKSSYKLSAEAKKP 67 + ++AIK LKERNGSS QAI K + N N+ H + AL+ V++GKF++VK SYKLS E +KP Sbjct: 87 LIVDAIKELKERNGSSRQAIAKVV--ENKKDNYASHHLNKALRTAVDAGKFIQVKGSYKLSPELRKP 151 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig995.21239.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pages
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig995.21239.1 ID=prot_F-serratus_M_contig995.21239.1|Name=mRNA_F-serratus_M_contig995.21239.1|organism=Fucus serratus male|type=polypeptide|length=175bpback to top |