prot_F-serratus_M_contig993.21223.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig993.21223.1 vs. uniprot
Match: A0A6H5JJH6_9PHAE (Kinesin motor domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJH6_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 4.580e-5 Identity = 33/60 (55.00%), Postives = 42/60 (70.00%), Query Frame = 0 Query: 4 IDRATSDALKQKAEFHEELAIANGRAEEAEARLGRRLADLERLMEAYERAQDALSAKSQE 63 I ++D L++ A+ EELA+A GRA+EAEA L R ADLERL + RAQ AL AK+QE Sbjct: 611 IREDSADMLQKTADLREELAVALGRAKEAEALLDRGRADLERLEDGQRRAQSALDAKNQE 670 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig993.21223.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig993.21223.1 ID=prot_F-serratus_M_contig993.21223.1|Name=mRNA_F-serratus_M_contig993.21223.1|organism=Fucus serratus male|type=polypeptide|length=179bpback to top |