prot_F-serratus_M_contig970.21042.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig970.21042.1 vs. uniprot
Match: A0A6H5KGD1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KGD1_9PHAE) HSP 1 Score: 73.2 bits (178), Expect = 5.600e-13 Identity = 37/88 (42.05%), Postives = 54/88 (61.36%), Query Frame = 0 Query: 8 QAKSDPCVFRKVVDGEAEMVVVVLVDDILAHAKDQASMDRFATEVGHKFKLKDMGDVGYYMGCHITRNCKARELKLDQHLYVESIVKK 95 +A DPCVFRKVVDGE ++V+ VDDIL A D+ + + KF +KD+G+ +Y GC I + + KL Q Y+ES++K+ Sbjct: 297 RALVDPCVFRKVVDGEVVGLIVIYVDDILV-AADEGEREELFASLNKKFPVKDLGECTWYDGCAIAMDVENGITKLSQTAYIESMLKR 383
BLAST of mRNA_F-serratus_M_contig970.21042.1 vs. uniprot
Match: A0A6H5JEM4_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JEM4_9PHAE) HSP 1 Score: 73.2 bits (178), Expect = 6.200e-13 Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 0 Query: 5 GFAQAKSDPCVFRKVVDGEAEMVVVVLVDDILAHAKDQASMDRFATEVGHKFKLKDMGDVGYYMGCHITRNCKARELKLDQHLYVESIVKK 95 G+ Q + DPCVFRKVVDGE ++V+ VDDIL A D+ + + KF +KD+ + +Y GC I + + KL Q Y+ES++++ Sbjct: 454 GYEQCRVDPCVFRKVVDGEVVGLIVIYVDDILVTA-DEGEREELFASLNKKFPVKDLEECTWYDGCAIAMDVENGLTKLSQTAYIESMLRR 543
BLAST of mRNA_F-serratus_M_contig970.21042.1 vs. uniprot
Match: A0A6H5KAM7_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAM7_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 8.480e-13 Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 0 Query: 5 GFAQAKSDPCVFRKVVDGEAEMVVVVLVDDILAHAKDQASMDRFATEVGHKFKLKDMGDVGYYMGCHITRNCKARELKLDQHLYVESIVKK 95 G+ Q + DPCVFRKVVDGE ++V+ VDDIL A D+ + + K +KD+G+ Y GC I + + KL Q Y+ES++K+ Sbjct: 396 GYEQYRVDPCVFRKVVDGEVVGLIVIYVDDILV-AADEGGREELFASLNKKSPVKDLGECTLYDGCAIAMDVENGITKLSQTAYIESMLKR 485
BLAST of mRNA_F-serratus_M_contig970.21042.1 vs. uniprot
Match: A0A6H5L6D0_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6D0_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 9.480e-13 Identity = 35/84 (41.67%), Postives = 51/84 (60.71%), Query Frame = 0 Query: 12 DPCVFRKVVDGEAEMVVVVLVDDILAHAKDQASMDRFATEVGHKFKLKDMGDVGYYMGCHITRNCKARELKLDQHLYVESIVKK 95 DPCV RKVVDGE ++V+ VDDIL A D+ + + KF +KD+G+ +Y GC I + + KL Q Y+ES++K+ Sbjct: 39 DPCVLRKVVDGEVVGLIVIYVDDILV-AADEGEREELFASLNKKFPVKDLGECTWYDGCAIAMDVENGITKLSQTAYIESMLKR 121
BLAST of mRNA_F-serratus_M_contig970.21042.1 vs. uniprot
Match: A0A6H5KCN6_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCN6_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 1.040e-12 Identity = 35/89 (39.33%), Postives = 56/89 (62.92%), Query Frame = 0 Query: 5 GFAQAKSDPCVFRKVVDGEAEMVVVVLVDDILAHAKDQASMDRFATEVGHKFKLKDMGDVGYYMGCHITRNCKARELKLDQHLYVESIV 93 G+ Q + DPC+FRKVVDGE ++V+ VDDI+ A ++ + A+ + +F +KD+GD +Y GC I + + KL Q Y+ES++ Sbjct: 74 GYEQCRVDPCIFRKVVDGEVVGLIVIYVDDIMLSATEEEREELLAS-LQKRFPVKDLGDCTWYDGCAIEVDLENGTTKLSQTAYIESML 161 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig970.21042.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pages
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig970.21042.1 ID=prot_F-serratus_M_contig970.21042.1|Name=mRNA_F-serratus_M_contig970.21042.1|organism=Fucus serratus male|type=polypeptide|length=103bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|