prot_F-serratus_M_contig96.20916.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig96.20916.1 vs. uniprot
Match: A0A315W0B3_GAMAF (Uncharacterized protein (Fragment) n=1 Tax=Gambusia affinis TaxID=33528 RepID=A0A315W0B3_GAMAF) HSP 1 Score: 58.9 bits (141), Expect = 4.890e-6 Identity = 32/75 (42.67%), Postives = 46/75 (61.33%), Query Frame = 0 Query: 439 LAAELTCPVCLCLFEDAHVLPCSHRFCLTCINGCFRSTKKQE----CPLCKVPAWKRD-LKRDVPLQNILLAYRS 508 LA EL+CP+CL L+ D VLPC H FCL CI+ ST + CP C+ P D L+++V L NI+ ++++ Sbjct: 10 LAQELSCPICLQLYNDPVVLPCGHNFCLACISKSADSTDNGKEPLRCPECREPHDGVDTLQKNVKLSNIVESFQA 84
BLAST of mRNA_F-serratus_M_contig96.20916.1 vs. uniprot
Match: UPI001EAF651E (E3 ubiquitin-protein ligase TRIM39-like n=1 Tax=Oncorhynchus gorbuscha TaxID=8017 RepID=UPI001EAF651E) HSP 1 Score: 57.8 bits (138), Expect = 5.140e-6 Identity = 21/47 (44.68%), Postives = 34/47 (72.34%), Query Frame = 0 Query: 439 LAAELTCPVCLCLFEDAHVLPCSHRFCLTCINGCFRSTKKQECPLCK 485 L +L+CPVC+ +F D +L CSH FC +C+ C++ ++ QECP+C+ Sbjct: 8 LEEDLSCPVCMDIFLDPVLLSCSHNFCKSCLQQCWKGSETQECPICR 54
BLAST of mRNA_F-serratus_M_contig96.20916.1 vs. uniprot
Match: UPI00077CE75E (zinc-binding protein A33-like n=1 Tax=Nothobranchius furzeri TaxID=105023 RepID=UPI00077CE75E) HSP 1 Score: 60.1 bits (144), Expect = 5.610e-6 Identity = 24/61 (39.34%), Postives = 40/61 (65.57%), Query Frame = 0 Query: 442 ELTCPVCLCLFEDAHVLPCSHRFCLTCINGCFRSTKKQECPLCKVPAWKRDLKRDVPLQNI 502 +L CP+CL +F+D +LPCSH FC C+ + + Q+CP+CK ++D+ R++ L N+ Sbjct: 8 DLHCPICLEVFKDPVILPCSHSFCKACLRSWWVEKRIQQCPICKNTCEEKDVLRNLALGNL 68
BLAST of mRNA_F-serratus_M_contig96.20916.1 vs. uniprot
Match: A0A3B4GT75_9CICH (RING-type domain-containing protein n=1 Tax=Pundamilia nyererei TaxID=303518 RepID=A0A3B4GT75_9CICH) HSP 1 Score: 58.2 bits (139), Expect = 6.120e-6 Identity = 24/66 (36.36%), Postives = 41/66 (62.12%), Query Frame = 0 Query: 437 MALAAELTCPVCLCLFEDAHVLPCSHRFCLTCINGCFRSTKKQECPLCKVPAWKRDLKRDVPLQNI 502 MA ++L CPVCL +F++ +LPCSH FC C++ +R +CP+C+ + D ++ L+N+ Sbjct: 13 MAARSDLCCPVCLDIFKEPVLLPCSHSFCKDCLDSWWRENPTHDCPVCQKQSTMHDPPCNLALKNL 78
BLAST of mRNA_F-serratus_M_contig96.20916.1 vs. uniprot
Match: A0A3P8PT67_ASTCA (Uncharacterized protein n=1 Tax=Astatotilapia calliptera TaxID=8154 RepID=A0A3P8PT67_ASTCA) HSP 1 Score: 58.5 bits (140), Expect = 6.500e-6 Identity = 24/66 (36.36%), Postives = 42/66 (63.64%), Query Frame = 0 Query: 437 MALAAELTCPVCLCLFEDAHVLPCSHRFCLTCINGCFRSTKKQECPLCKVPAWKRDLKRDVPLQNI 502 MA ++L CPVCL +F++ +LPCSH FC C++ +R ++CP+C+ + D ++ L+N+ Sbjct: 1 MAARSDLCCPVCLDIFKEPVLLPCSHSFCKDCLDSWWRENPARDCPVCQKQSTMHDPPCNLALKNL 66 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig96.20916.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pages
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig96.20916.1 ID=prot_F-serratus_M_contig96.20916.1|Name=mRNA_F-serratus_M_contig96.20916.1|organism=Fucus serratus male|type=polypeptide|length=512bpback to top |