prot_F-serratus_M_contig94.20764.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig94.20764.1 vs. uniprot
Match: D7G0Z8_ECTSI (Pribosyltran domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0Z8_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 2.940e-12 Identity = 31/38 (81.58%), Postives = 37/38 (97.37%), Query Frame = 0 Query: 1 MVTNSIPTTTDRLPRDDVYVVLDLADRIKDDLDLHSSI 38 +VTNSIPTTTD+LP+DDVYVVLDL +RIK+DLDLHSS+ Sbjct: 303 LVTNSIPTTTDKLPKDDVYVVLDLVNRIKEDLDLHSSV 340
BLAST of mRNA_F-serratus_M_contig94.20764.1 vs. uniprot
Match: A0A835YPL2_9STRA (Phosphoribosyltransferase-like protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YPL2_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 7.580e-8 Identity = 25/36 (69.44%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 2 VTNSIPTTTDRLPRDDVYVVLDLADRIKDDLDLHSS 37 +TNSIPTTTDRLP+DDVY VLD++D+I DLD ++S Sbjct: 303 LTNSIPTTTDRLPKDDVYTVLDISDKIVQDLDKYTS 338
BLAST of mRNA_F-serratus_M_contig94.20764.1 vs. uniprot
Match: F0Y0J1_AURAN (Pribosyltran domain-containing protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y0J1_AURAN) HSP 1 Score: 50.1 bits (118), Expect = 6.060e-6 Identity = 24/32 (75.00%), Postives = 28/32 (87.50%), Query Frame = 0 Query: 2 VTNSIPTTTDRLPRDDVYVVLDLADRIKDDLD 33 VTNSIPTTT++LPRDDV+ V+DL RI DDLD Sbjct: 267 VTNSIPTTTNKLPRDDVFTVIDLTARIVDDLD 298
BLAST of mRNA_F-serratus_M_contig94.20764.1 vs. uniprot
Match: A0A7S0GEW9_9STRA (Hypothetical protein n=1 Tax=Proboscia inermis TaxID=420281 RepID=A0A7S0GEW9_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 8.530e-6 Identity = 25/36 (69.44%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 2 VTNSIPTTTDRLPRDDVYVVLDLADRIKDDLDLHSS 37 VTNSIPT TD LP+DDV+ VL L +I DDLDL+SS Sbjct: 362 VTNSIPTVTDVLPKDDVFEVLKLTQQIIDDLDLYSS 397
BLAST of mRNA_F-serratus_M_contig94.20764.1 vs. uniprot
Match: A0A8J2WWS0_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2WWS0_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 4.090e-5 Identity = 22/32 (68.75%), Postives = 28/32 (87.50%), Query Frame = 0 Query: 2 VTNSIPTTTDRLPRDDVYVVLDLADRIKDDLD 33 VTNSIPTTTD+LP +DV+ V+DL +R+ DDLD Sbjct: 314 VTNSIPTTTDKLPSNDVFEVIDLTERVIDDLD 345 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig94.20764.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig94.20764.1 ID=prot_F-serratus_M_contig94.20764.1|Name=mRNA_F-serratus_M_contig94.20764.1|organism=Fucus serratus male|type=polypeptide|length=39bpback to top |