prot_F-serratus_M_contig933.20722.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5KWE4_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWE4_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 1.940e-8 Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYGRKSSLQHLQPF 77 PQYNGVAER GL+ ++A + + + DR+WAEA+++AC+ + S+ SPYE W+G S H +P+ Sbjct: 77 PQYNGVAERGLGLIEAAAMAARIQAKVLFGHVQLPKTDRLWAEAMHWACEAINHTACSANPDSKSPYEMWHGEAS---HARPY 156
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5KVR5_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVR5_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.360e-8 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYG 66 PQYNGVAER GL+ E ++A + + + D++WAEA+++AC+ + S+ SPYE WYG Sbjct: 191 PQYNGVAERGLGLIEEAAMAARIQAKVLFGHVQLPKTDKLWAEAMHWACEAMNHTACSANPDSMSPYEMWYG 262
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A0A9XC07_LYGHE (Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) n=1 Tax=Lygus hesperus TaxID=30085 RepID=A0A0A9XC07_LYGHE) HSP 1 Score: 58.9 bits (141), Expect = 2.490e-8 Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIAMLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYGRKSSLQHLQPFG 78 PQ NG +ER + K+ A+L E G D +W EA+ A + + TS+++ T+P+EKWYGRK + H+Q FG Sbjct: 8 PQLNGKSERIGRTIMNKARALLMES--GLNDEMWGEAVQVAAYLLNRGYTSTVD--TTPFEKWYGRKPDMSHIQKFG 80
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5JV76_9PHAE (Integrase catalytic domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV76_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.530e-8 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYG 66 PQYNGVAER GL+ E ++A + + + D++WAEA+++AC+ + S+ SPYE WYG Sbjct: 411 PQYNGVAERGLGLIEEAAMAARIQAKVLFGHVQLPKTDKLWAEAMHWACEAMNHTACSANPDSMSPYEMWYG 482
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5K2M6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2M6_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.580e-8 Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYGRKSSLQHLQPF 77 PQYNGVAER GL+ ++A + + + DR+WAEA+++AC+ + S+ SPYE W+G S H +P+ Sbjct: 729 PQYNGVAERGLGLIEAAAMAARIQAKVLFGHVQLPKTDRLWAEAMHWACEAINHTACSANPDSKSPYEMWHGEAS---HARPY 808
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5KKK1_9PHAE (Integrase catalytic domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKK1_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.590e-8 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYG 66 PQYNGVAER GL+ E ++A + + + D++WAEA+++AC+ + S+ SPYE WYG Sbjct: 77 PQYNGVAERGLGLIEEAAMAARIQAKVLFGHVQLPKTDKLWAEAMHWACEAMNHTACSANPDSMSPYEMWYG 148
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5JRL9_9PHAE (Integrase catalytic domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRL9_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.610e-8 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYG 66 PQYNGVAER GL+ E ++A + + + D++WAEA+++AC+ + S+ SPYE WYG Sbjct: 344 PQYNGVAERGLGLIEEAAMAARIQAKVLFGHVQLPKTDKLWAEAMHWACEAMNHTACSANPDSMSPYEMWYG 415
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5JBA7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JBA7_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.610e-8 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYG 66 PQYNGVAER GL+ E ++A + + + D++WAEA+++AC+ + S+ SPYE WYG Sbjct: 823 PQYNGVAERGLGLIEEAAMAARIQAKVLFGHVQLPKTDKLWAEAMHWACEAMNHTACSANPDSKSPYEMWYG 894
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5KZH7_9PHAE (Uncharacterized protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZH7_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.610e-8 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYG 66 PQYNGVAER GL+ E ++A + + + D++WAEA+++AC+ + S+ SPYE WYG Sbjct: 530 PQYNGVAERGLGLIEEAAMAARIQAKVLFGHVQLPKTDKLWAEAMHWACEAMNHTACSANPDSKSPYEMWYG 601
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Match: A0A6H5JB16_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JB16_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.620e-8 Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 0 Query: 2 PQYNGVAERAFGLLREKSIA-------MLEEMTVGACDRIWAEALNYACDMCDMCVTSSLEGGTSPYEKWYG 66 PQYNGVAER GL+ E ++A + + + D++WAEA+++AC+ + S+ SPYE WYG Sbjct: 427 PQYNGVAERGLGLIEEAAMAARIQAKVLFGHVQLPKTDKLWAEAMHWACEALNHTACSANPDSKSPYEMWYG 498 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig933.20722.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig933.20722.1 ID=prot_F-serratus_M_contig933.20722.1|Name=mRNA_F-serratus_M_contig933.20722.1|organism=Fucus serratus male|type=polypeptide|length=79bpback to top |