prot_F-serratus_M_contig102.277.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A8J2S2K0_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2S2K0_9STRA) HSP 1 Score: 85.5 bits (210), Expect = 4.420e-17 Identity = 37/64 (57.81%), Postives = 45/64 (70.31%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFLDDFLKQQATNGASMSGSGTTPP 64 MPRY+CDYC YLTHDSAPGR+QH RGWKH +NVK +Y+Q++ F +Q SG G PP Sbjct: 1 MPRYFCDYCDVYLTHDSAPGRKQHIRGWKHRENVKQYYEQYMKQFYEQN-------SGMGMMPP 57
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A6A3U2G8_9STRA (U1 small nuclear ribonucleoprotein C n=2 Tax=Phytophthora fragariae TaxID=53985 RepID=A0A6A3U2G8_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 1.280e-16 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL 42
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A024G168_9STRA (U1 small nuclear ribonucleoprotein C n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024G168_9STRA) HSP 1 Score: 82.4 bits (202), Expect = 1.450e-16 Identity = 33/42 (78.57%), Postives = 37/42 (88.10%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+Q L Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQLL 42
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A1V9Z7R9_9STRA (U1 small nuclear ribonucleoprotein C n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9Z7R9_9STRA) HSP 1 Score: 82.4 bits (202), Expect = 1.690e-16 Identity = 41/74 (55.41%), Postives = 49/74 (66.22%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFLDDFLKQQATNGASMS-GSGTTPPAARPVNPSP 73 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+ + + NGA M+ G+ P A R P P Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEATVQN-------NGAMMTPGAWLRPDALRGGPPRP 67
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A3R6X1P8_9STRA (Matrin-type domain-containing protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A3R6X1P8_9STRA) HSP 1 Score: 80.1 bits (196), Expect = 1.710e-16 Identity = 32/42 (76.19%), Postives = 36/42 (85.71%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+ L Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEAML 42 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pages
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig102.277.1 ID=prot_F-serratus_M_contig102.277.1|Name=mRNA_F-serratus_M_contig102.277.1|organism=Fucus serratus male|type=polypeptide|length=216bpback to top |