prot_F-serratus_M_contig102.277.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: H3GZT7_PHYRM (U1 small nuclear ribonucleoprotein C n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GZT7_PHYRM) HSP 1 Score: 86.3 bits (212), Expect = 1.080e-17 Identity = 43/76 (56.58%), Postives = 49/76 (64.47%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFLDDFLKQQATNGASMSGS----GTTPPAARPVNPS 72 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL A G M+ G T P + P PS Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL-------AGQGVVMTPGEWLRGPTVPGSLPPRPS 69
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A329S385_9STRA (Matrin-type domain-containing protein n=1 Tax=Phytophthora cactorum TaxID=29920 RepID=A0A329S385_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 1.110e-17 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL 42
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A7S2BRH0_9STRA (U1 small nuclear ribonucleoprotein C n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2BRH0_9STRA) HSP 1 Score: 86.7 bits (213), Expect = 1.180e-17 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFLDDF 45 MPRYYCDYC TYLTHDSAPGR+QH RGWKH +NVK +Y+QF+ +F Sbjct: 21 MPRYYCDYCDTYLTHDSAPGRKQHMRGWKHRENVKQYYEQFMSEF 65
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A8K1FL98_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1FL98_PYTOL) HSP 1 Score: 85.1 bits (209), Expect = 1.380e-17 Identity = 42/75 (56.00%), Postives = 47/75 (62.67%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFLDD----FLKQQATNGASMSGSGTTPPAARPVNP 71 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Q G M+G PP P P Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFLTGQGVMMAPGQWLRGPPMAGG--MPPRPGPGGP 73
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: K3WTM9_GLOUD (U1 small nuclear ribonucleoprotein C n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WTM9_GLOUD) HSP 1 Score: 84.7 bits (208), Expect = 2.090e-17 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL 42
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A0P1AIX6_PLAHL (U1 small nuclear ribonucleoprotein C n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1AIX6_PLAHL) HSP 1 Score: 84.7 bits (208), Expect = 2.200e-17 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL 42
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: RU1C_PHYIT (U1 small nuclear ribonucleoprotein C n=11 Tax=Phytophthora TaxID=4783 RepID=RU1C_PHYIT) HSP 1 Score: 84.7 bits (208), Expect = 2.260e-17 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL 42
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: M4C139_HYAAE (Matrin-type domain-containing protein n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4C139_HYAAE) HSP 1 Score: 84.7 bits (208), Expect = 2.700e-17 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL 42
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A662XYV9_9STRA (U1 small nuclear ribonucleoprotein C n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XYV9_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 2.700e-17 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL 42
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Match: A0A484E4H6_BRELC (U1 small nuclear ribonucleoprotein C n=1 Tax=Bremia lactucae TaxID=4779 RepID=A0A484E4H6_BRELC) HSP 1 Score: 84.7 bits (208), Expect = 3.720e-17 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 1 MPRYYCDYCGTYLTHDSAPGRRQHNRGWKHTDNVKLHYKQFL 42 MPRYYCDYC TYLTHDS GR+QHNRGWKH +NVKL+Y+QFL Sbjct: 1 MPRYYCDYCDTYLTHDSQAGRKQHNRGWKHRENVKLYYEQFL 42 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig102.277.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig102.277.1 ID=prot_F-serratus_M_contig102.277.1|Name=mRNA_F-serratus_M_contig102.277.1|organism=Fucus serratus male|type=polypeptide|length=216bpback to top |