prot_F-serratus_M_contig101.189.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig101.189.1 vs. uniprot
Match: A0A7S4IDD1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Odontella aurita TaxID=265563 RepID=A0A7S4IDD1_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 3.530e-7 Identity = 38/101 (37.62%), Postives = 61/101 (60.40%), Query Frame = 0 Query: 299 DICSETFRKAVAESMGATGIVIDEYRAKLDELAERLGLTVRSAKAMFHAAVRQRMGPMVQQIMYEFERSVLSKGEMARKTGKDSGADVL--GATG-GQLGI 396 ++ E + V E G G+ E L +L RLG+T +A+ ++ AAV++RM PMV+ ++ E ER++L + ++A+K KD G DV G +G G+LGI Sbjct: 5 EVLGEFKKGVVLEEGGPRGVPRPESGEPLVDLRNRLGVTEDAARELYLAAVKERMVPMVEDLVLELERTMLDQQQLAQKRKKDFGEDVFKSGRSGSGKLGI 105 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig101.189.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 11
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig101.189.1 ID=prot_F-serratus_M_contig101.189.1|Name=mRNA_F-serratus_M_contig101.189.1|organism=Fucus serratus male|type=polypeptide|length=536bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|