prot_F-serratus_M_contig1001.121.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1001.121.1 vs. uniprot
Match: M2Y0D2_GALSU (Chaperone protein / DnaJ-related protein n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2Y0D2_GALSU) HSP 1 Score: 57.4 bits (137), Expect = 8.010e-7 Identity = 35/104 (33.65%), Postives = 49/104 (47.12%), Query Frame = 0 Query: 103 PDTVYSAKEWIAGVAGGSVGVLGTLIQLELKQEALRSRRNCPYCNGSGKLVCAMCCSAGTFTMKLPGAET-YSTLPXXXXXXXXXXXXLNCRGDGRAVPRELDR 205 P TV E + +AGG+VGV+GTL+ LE+ ++ + R CPYC G KL C +C G +P Y +C G GR +P E +R Sbjct: 47 PPTV---NEVTSALAGGTVGVMGTLLVLEVIRQRIEEMRQCPYCRGLRKLPCGLCYGMGF----IPDVSCLYCKSDCENCGGEGSVLCCHCDGSGRYLPVEYER 143 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1001.121.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 11
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1001.121.1 ID=prot_F-serratus_M_contig1001.121.1|Name=mRNA_F-serratus_M_contig1001.121.1|organism=Fucus serratus male|type=polypeptide|length=226bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|