mRNA_F-serratus_M_contig1059.581.1 (mRNA) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6S7FI90_PARCT (ATP-dependent DNA helicase n=2 Tax=Paramuricea clavata TaxID=317549 RepID=A0A6S7FI90_PARCT) HSP 1 Score: 52.4 bits (124), Expect = 9.870e-6 Identity = 23/52 (44.23%), Postives = 40/52 (76.92%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 G+T+V +SR + L+ L+IEP+TF+RL+ + + L+ R++EEERL+ +A +T Sbjct: 716 GMTYVAISRVRNLSSLIIEPITFDRLTSIKQLEALKYRVKEEERLKKIARKT 767
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI00109BE5C8 (uncharacterized protein LOC110237019 n=1 Tax=Exaiptasia diaphana TaxID=2652724 RepID=UPI00109BE5C8) HSP 1 Score: 52.4 bits (124), Expect = 1.020e-5 Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET---LHHH 242 G+++V +SR K L L+IEPM+FERL+ + TL+ RLREE RL LA T H+H Sbjct: 1972 GISYVAISRVKTLASLVIEPMSFERLTSVRSSTTLQYRLREESRLDDLAQLTNNAFHYH 2030
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI000E6FAFB5 (uncharacterized protein LOC113291610 n=1 Tax=Papaver somniferum TaxID=3469 RepID=UPI000E6FAFB5) HSP 1 Score: 49.7 bits (117), Expect = 3.350e-5 Identity = 29/50 (58.00%), Postives = 35/50 (70.00%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMT-FERLSKLGEKPTLRLRLREEERLRALA 221 GLTFV LSR +RL+DL PM FER+ K+GE L R REEERL+ L+ Sbjct: 109 GLTFVALSRTRRLSDLAFHPMLRFERIYKIGECKALPERRREEERLQELS 158
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A7J7NPJ0_9MAGN (ATP-dependent DNA helicase n=1 Tax=Kingdonia uniflora TaxID=39325 RepID=A0A7J7NPJ0_9MAGN) HSP 1 Score: 49.7 bits (117), Expect = 8.250e-5 Identity = 28/50 (56.00%), Postives = 36/50 (72.00%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPM-TFERLSKLGEKPTLRLRLREEERLRALA 221 GLTFV LSR ++L+DL +PM TFERL KLG+ L R+ EEE LR ++ Sbjct: 337 GLTFVALSRTRKLSDLAFKPMFTFERLQKLGKCAGLNSRMEEEECLRLMS 386
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A7J6WG84_THATH (ATP-dependent DNA helicase n=1 Tax=Thalictrum thalictroides TaxID=46969 RepID=A0A7J6WG84_THATH) HSP 1 Score: 49.7 bits (117), Expect = 8.530e-5 Identity = 28/50 (56.00%), Postives = 36/50 (72.00%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPM-TFERLSKLGEKPTLRLRLREEERLRALA 221 LTFV LSR ++L+DL PM TFERL K+G+ L+ RL EEERLR ++ Sbjct: 479 SLTFVALSRTRKLSDLAFSPMFTFERLQKIGKCAGLKPRLDEEERLRIMS 528 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pages
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_F-serratus_M_contig1059.581.1 >prot_F-serratus_M_contig1059.581.1 ID=prot_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=polypeptide|length=76bp MLLLPRPRGWLLGHYGLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLback to top mRNA from alignment at F-serratus_M_contig1059:106996..107623+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_F-serratus_M_contig1059.581.1 ID=mRNA_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=mRNA|length=628bp|location=Sequence derived from alignment at F-serratus_M_contig1059:106996..107623+ (Fucus serratus male)back to top Coding sequence (CDS) from alignment at F-serratus_M_contig1059:106996..107623+ >mRNA_F-serratus_M_contig1059.581.1 ID=mRNA_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=CDS|length=456bp|location=Sequence derived from alignment at F-serratus_M_contig1059:106996..107623+ (Fucus serratus male)back to top |