mRNA_F-serratus_M_contig1059.581.1 (mRNA) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5JGH7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGH7_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 3.330e-10 Identity = 29/43 (67.44%), Postives = 37/43 (86.05%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEE 203 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EEE Sbjct: 469 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEE 511
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5L976_9PHAE (ATP-dependent DNA helicase n=4 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L976_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 1.210e-9 Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREE-----ERLRALAGETLH 236 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE +R A+ E+ H Sbjct: 1527 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEASDALDRQNAIFDESGH 1585
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI000C038F98 (ATP-dependent DNA helicase PIF6-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C038F98) HSP 1 Score: 55.5 bits (132), Expect = 2.290e-7 Identity = 27/56 (48.21%), Postives = 39/56 (69.64%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGETLHHH 242 GL ++ LSR ++L+DL+IEPM FERL + + + RL EE RL LA +TLH++ Sbjct: 107 GLAYIALSRVRKLSDLVIEPMGFERLQSIKKTSNYKFRLLEEARLNILAEKTLHNY 162
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A7D9JY90_PARCT (UvrD_C_2 domain-containing protein (Fragment) n=1 Tax=Paramuricea clavata TaxID=317549 RepID=A0A7D9JY90_PARCT) HSP 1 Score: 53.5 bits (127), Expect = 2.980e-7 Identity = 26/52 (50.00%), Postives = 40/52 (76.92%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 230 G+T+V +SRA+ L L+IEPMTF+RL+ + + +L+ RL EE+RL+A+A T Sbjct: 40 GMTYVAISRARNLLSLIIEPMTFDRLTCIKKNESLQYRLEEEKRLQAIANFT 91
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6S7JIW3_PARCT (ATP-dependent DNA helicase n=1 Tax=Paramuricea clavata TaxID=317549 RepID=A0A6S7JIW3_PARCT) HSP 1 Score: 56.6 bits (135), Expect = 3.250e-7 Identity = 28/53 (52.83%), Postives = 41/53 (77.36%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGETL 233 G+T+V LSRA+ LT L+IEPMT++RLS + + +L RL+EE+RL+ +A TL Sbjct: 1064 GITYVALSRARNLTSLVIEPMTYDRLSSIKKMQSLSYRLQEEKRLQVIANLTL 1116
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI00077A45EF (ATP-dependent DNA helicase PIF7-like n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077A45EF) HSP 1 Score: 54.7 bits (130), Expect = 1.520e-6 Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGETLHHHGGV 251 GL +V LSR +R+TDL+I+PM+FERL L + + RL EE RL LA T+ H G+ Sbjct: 702 GLAYVALSRVRRITDLVIKPMSFERLHLLKKTSNYKFRLLEEARLDKLAQRTVESHIGL 760
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A7J6WDW9_THATH (Atp-dependent dna helicase pif1 n=1 Tax=Thalictrum thalictroides TaxID=46969 RepID=A0A7J6WDW9_THATH) HSP 1 Score: 52.8 bits (125), Expect = 3.090e-6 Identity = 30/50 (60.00%), Postives = 37/50 (74.00%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPM-TFERLSKLGEKPTLRLRLREEERLRALA 221 GLTFV LSR ++L+DL PM TFERL K+G+ L+ RL EEERLR +A Sbjct: 132 GLTFVALSRTRKLSDLAFSPMFTFERLHKIGKCAGLKPRLDEEERLRIMA 181
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI000C045087 (uncharacterized protein LOC111325086 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C045087) HSP 1 Score: 53.5 bits (127), Expect = 3.950e-6 Identity = 31/58 (53.45%), Postives = 39/58 (67.24%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRAL---AGETLHH 239 G+T+V LSR KRL DL+IEPMTFERL + L+ RL EE+RL +L A + HH Sbjct: 1133 GMTYVALSRVKRLQDLIIEPMTFERLQAYKKSNFLKYRLIEEKRLDSLSLNASKNGHH 1190
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A3M6TBZ5_POCDA (ATP-dependent DNA helicase n=2 Tax=Pocillopora damicornis TaxID=46731 RepID=A0A3M6TBZ5_POCDA) HSP 1 Score: 53.5 bits (127), Expect = 3.980e-6 Identity = 31/58 (53.45%), Postives = 39/58 (67.24%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRAL---AGETLHH 239 G+T+V LSR KRL DL+IEPMTFERL + L+ RL EE+RL +L A + HH Sbjct: 1078 GMTYVALSRVKRLQDLIIEPMTFERLQAYKKSNFLKYRLIEEKRLDSLSLNASKNGHH 1135
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI000A2A6B3A (uncharacterized protein LOC110247455 n=1 Tax=Exaiptasia diaphana TaxID=2652724 RepID=UPI000A2A6B3A) HSP 1 Score: 52.8 bits (125), Expect = 7.190e-6 Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 3 Query: 75 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGETLHHH 242 G+++V +SR K L+ L+IEPMTFERL+ + TL RL EE RL LA T H Sbjct: 658 GISYVAISRVKTLSSLVIEPMTFERLTAIKSSTTLHYRLEEESRLDYLAESTRASH 713 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_F-serratus_M_contig1059.581.1 >prot_F-serratus_M_contig1059.581.1 ID=prot_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=polypeptide|length=76bp MLLLPRPRGWLLGHYGLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLback to top mRNA from alignment at F-serratus_M_contig1059:106996..107623+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_F-serratus_M_contig1059.581.1 ID=mRNA_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=mRNA|length=628bp|location=Sequence derived from alignment at F-serratus_M_contig1059:106996..107623+ (Fucus serratus male)back to top Coding sequence (CDS) from alignment at F-serratus_M_contig1059:106996..107623+ >mRNA_F-serratus_M_contig1059.581.1 ID=mRNA_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=CDS|length=456bp|location=Sequence derived from alignment at F-serratus_M_contig1059:106996..107623+ (Fucus serratus male)back to top |