mRNA_F-serratus_M_contig1051.552.1 (mRNA) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1051.552.1 vs. uniprot
Match: A0A7N0R894_KALFE (Mitogen-activated protein kinase n=2 Tax=Kalanchoe fedtschenkoi TaxID=63787 RepID=A0A7N0R894_KALFE) HSP 1 Score: 52.0 bits (123), Expect = 5.930e-5 Identity = 27/76 (35.53%), Postives = 44/76 (57.89%), Query Frame = 1 Query: 13 PGINSDAASLMTNLLLFDPDKRCTASEALLHSFFEDFRNDDPLKGDTPTGLHFEFEHRSVSTTTLRDLIAKEVDYF 240 P +++ A L+ +L+FDP+KR TA EAL H + F +D ++ P F+FE S++ +++LI KE F Sbjct: 297 PSMSAQAIDLLEKMLVFDPEKRVTAEEALSHPYLAPF-HDLSVEPVCPRAFVFDFEQSSLTEEDIKELIWKESILF 371
BLAST of mRNA_F-serratus_M_contig1051.552.1 vs. uniprot
Match: A0A6I9SKB3_ELAGV (Mitogen-activated protein kinase n=6 Tax=commelinids TaxID=4734 RepID=A0A6I9SKB3_ELAGV) HSP 1 Score: 52.0 bits (123), Expect = 6.080e-5 Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 1 Query: 13 PGINSDAASLMTNLLLFDPDKRCTASEALLHSFFEDFR--NDDPLKGDTPTGLHFEFEHRSVSTTTLRDLIAKEVDYF 240 P ++S A L+ +L+FDP KR T +EAL H + + ND+P+ P F+FE S + +++L+ +E F Sbjct: 332 PNVSSGAVDLLEKMLVFDPSKRITVTEALCHPYLASYHDINDEPV---CPAPFSFDFEQPSFTEEDVKELVWRETLKF 406
BLAST of mRNA_F-serratus_M_contig1051.552.1 vs. uniprot
Match: A0A0L8RMQ4_SACEU (Mitogen-activated protein kinase n=1 Tax=Saccharomyces eubayanus TaxID=1080349 RepID=A0A0L8RMQ4_SACEU) HSP 1 Score: 52.0 bits (123), Expect = 6.230e-5 Identity = 32/82 (39.02%), Postives = 46/82 (56.10%), Query Frame = 1 Query: 7 LLPGINSDAASLMTNLLLFDPDKRCTASEALLHSFFEDFRNDDPLKGDTPTG-----LHFEFEHRSVSTTT--LRDLIAKEV 231 LLP +N+ L+ +L+FDP+KR TA EAL H + + + DP GD P G FEF++ + TT L+ LI E+ Sbjct: 375 LLPSVNAQGVDLLQRMLVFDPEKRITAKEALEHPYLQTYH--DP--GDEPEGECIPPSFFEFDNYKEALTTKDLKKLIWNEI 452 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1051.552.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_F-serratus_M_contig1051.552.1 >prot_F-serratus_M_contig1051.552.1 ID=prot_F-serratus_M_contig1051.552.1|Name=mRNA_F-serratus_M_contig1051.552.1|organism=Fucus serratus male|type=polypeptide|length=148bp MDLLPGINSDAASLMTNLLLFDPDKRCTASEALLHSFFEDFRNDDPLKGDback to top mRNA from alignment at F-serratus_M_contig1051:279328..280082- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_F-serratus_M_contig1051.552.1 ID=mRNA_F-serratus_M_contig1051.552.1|Name=mRNA_F-serratus_M_contig1051.552.1|organism=Fucus serratus male|type=mRNA|length=755bp|location=Sequence derived from alignment at F-serratus_M_contig1051:279328..280082- (Fucus serratus male)back to top Coding sequence (CDS) from alignment at F-serratus_M_contig1051:279328..280082- >mRNA_F-serratus_M_contig1051.552.1 ID=mRNA_F-serratus_M_contig1051.552.1|Name=mRNA_F-serratus_M_contig1051.552.1|organism=Fucus serratus male|type=CDS|length=888bp|location=Sequence derived from alignment at F-serratus_M_contig1051:279328..280082- (Fucus serratus male)back to top |