mRNA_F-serratus_M_contig1022.297.1 (mRNA) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1022.297.1 vs. uniprot
Match: A0A6H5JRP4_9PHAE (HTH CENPB-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRP4_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 1.700e-15 Identity = 42/47 (89.36%), Postives = 44/47 (93.62%), Query Frame = -2 Query: 356 RQFGDLEGIAERCSMAGVSYHLRKAKLAWMSEAGSKKTKQTRMADFM 496 RQFGDLE IAERCSMAGV+YHLRKAK+AWMSEAGSKKTKQT MAD M Sbjct: 485 RQFGDLEEIAERCSMAGVAYHLRKAKIAWMSEAGSKKTKQTCMADSM 531
BLAST of mRNA_F-serratus_M_contig1022.297.1 vs. uniprot
Match: A0A6H5JHY0_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHY0_9PHAE) HSP 1 Score: 85.5 bits (210), Expect = 2.650e-15 Identity = 44/48 (91.67%), Postives = 45/48 (93.75%), Query Frame = -2 Query: 356 RQFGDLEGI-AERCSMAGVSYHLRKAKLAWMSEAGSKKTKQTRMADFM 496 RQFGDLE I AERCSMAGV+YHLRKAKLAWMSEAGSKKTKQT MADFM Sbjct: 412 RQFGDLEEIIAERCSMAGVAYHLRKAKLAWMSEAGSKKTKQTCMADFM 459
BLAST of mRNA_F-serratus_M_contig1022.297.1 vs. uniprot
Match: A0A6H5JNH8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNH8_9PHAE) HSP 1 Score: 84.0 bits (206), Expect = 8.510e-15 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = -2 Query: 356 RQFGDLEGIAERCSMAGVSYHLRKAKLAWMSEAGSKKTKQTRMADFM 496 RQF DLE AERCSMAGV+YHLRKAKLAWMSEAGSKKTKQT MADFM Sbjct: 396 RQFVDLEEKAERCSMAGVAYHLRKAKLAWMSEAGSKKTKQTCMADFM 442 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1022.297.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 13
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_F-serratus_M_contig1022.297.1 >prot_F-serratus_M_contig1022.297.1 ID=prot_F-serratus_M_contig1022.297.1|Name=mRNA_F-serratus_M_contig1022.297.1|organism=Fucus serratus male|type=polypeptide|length=142bp MRERLKPTMVQLSLPVKVKHLQYILAFNGQTSMTYACRHQLLQRYMKSAMback to top mRNA from alignment at F-serratus_M_contig1022:36640..37439+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_F-serratus_M_contig1022.297.1 ID=mRNA_F-serratus_M_contig1022.297.1|Name=mRNA_F-serratus_M_contig1022.297.1|organism=Fucus serratus male|type=mRNA|length=800bp|location=Sequence derived from alignment at F-serratus_M_contig1022:36640..37439+ (Fucus serratus male)back to top Coding sequence (CDS) from alignment at F-serratus_M_contig1022:36640..37439+ >mRNA_F-serratus_M_contig1022.297.1 ID=mRNA_F-serratus_M_contig1022.297.1|Name=mRNA_F-serratus_M_contig1022.297.1|organism=Fucus serratus male|type=CDS|length=852bp|location=Sequence derived from alignment at F-serratus_M_contig1022:36640..37439+ (Fucus serratus male)back to top |