mRNA_F-serratus_M_contig101.201.1 (mRNA) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig101.201.1 vs. uniprot
Match: A0A6H5JV45_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV45_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 1.870e-5 Identity = 30/80 (37.50%), Postives = 42/80 (52.50%), Query Frame = -3 Query: 186 CILHNMLHAYDGLDKLEEDVDWAGGDGLHDSITD----PSVTPATDCSSVGGPSNNESVEVEPSHDELKRKLITSFTYRK 413 CI+HNMLH +DGL LE+DVDWAG DG D T P+ T V N E+ ++ +++L+ Y+K Sbjct: 352 CIIHNMLHQFDGLANLEKDVDWAGKDGEADQTTGAFPVPTAVVDTAGEEVDDGDNTEAFKL------FRQQLVNHVAYKK 425
BLAST of mRNA_F-serratus_M_contig101.201.1 vs. uniprot
Match: A0A6H5K9X5_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K9X5_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 2.630e-5 Identity = 21/32 (65.62%), Postives = 25/32 (78.12%), Query Frame = -3 Query: 321 CCILHNMLHAYDGLDKLEEDVDWAGGDGLHDS 416 CC LHNMLHA+DGLD+LE +W G GLHD+ Sbjct: 423 CCTLHNMLHAFDGLDELESAEEWGGRAGLHDA 454
BLAST of mRNA_F-serratus_M_contig101.201.1 vs. uniprot
Match: D7FV01_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FV01_ECTSI) HSP 1 Score: 51.6 bits (122), Expect = 5.590e-5 Identity = 32/91 (35.16%), Postives = 40/91 (43.96%), Query Frame = -3 Query: 156 CILHNMLHAYDGLDKLEEDVDWAGGDG-LHDSITDPSVTPATDCSSVGGPSNNE----SVEVEPSHDELKRKLITSFTYRKEHNDIVWLTR 413 CILHNMLH ++GLD++EED DW G G L D P VG E + P D + KL+ F Y + W R Sbjct: 214 CILHNMLHKFNGLDEMEEDADWVGSAGELGDMPQQP----------VGMGDEKEXXXXTETAAPGFDGFRAKLVAHFAYMWRIKQVFWFKR 294 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig101.201.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 23
Pages
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_F-serratus_M_contig101.201.1 >prot_F-serratus_M_contig101.201.1 ID=prot_F-serratus_M_contig101.201.1|Name=mRNA_F-serratus_M_contig101.201.1|organism=Fucus serratus male|type=polypeptide|length=110bp MRKLFGRARPASVHVSIVHIFMHPCLESKAYLVSQTMSLCSLRYVKEVMSback to top mRNA from alignment at F-serratus_M_contig101:799578..799995+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_F-serratus_M_contig101.201.1 ID=mRNA_F-serratus_M_contig101.201.1|Name=mRNA_F-serratus_M_contig101.201.1|organism=Fucus serratus male|type=mRNA|length=418bp|location=Sequence derived from alignment at F-serratus_M_contig101:799578..799995+ (Fucus serratus male)back to top Coding sequence (CDS) from alignment at F-serratus_M_contig101:799578..799995+ >mRNA_F-serratus_M_contig101.201.1 ID=mRNA_F-serratus_M_contig101.201.1|Name=mRNA_F-serratus_M_contig101.201.1|organism=Fucus serratus male|type=CDS|length=660bp|location=Sequence derived from alignment at F-serratus_M_contig101:799578..799995+ (Fucus serratus male)back to top |