mRNA_F-distichus_contig100.4.1 (mRNA) Fucus distichus monoicous
|
Overview
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_F-distichus_contig100.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_F-distichus_contig100.4.1 >prot_F-distichus_contig100.4.1 ID=prot_F-distichus_contig100.4.1|Name=mRNA_F-distichus_contig100.4.1|organism=Fucus distichus monoicous|type=polypeptide|length=118bp MELATLREIKDTPHEQYFGVCEKWGRLAYLFAPDDLLIMAGGSGHTCAVVback to top mRNA from alignment at F-distichus_contig100:1268..1773+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_F-distichus_contig100.4.1 ID=mRNA_F-distichus_contig100.4.1|Name=mRNA_F-distichus_contig100.4.1|organism=Fucus distichus monoicous|type=mRNA|length=506bp|location=Sequence derived from alignment at F-distichus_contig100:1268..1773+ (Fucus distichus monoicous)back to top Coding sequence (CDS) from alignment at F-distichus_contig100:1268..1773+ >mRNA_F-distichus_contig100.4.1 ID=mRNA_F-distichus_contig100.4.1|Name=mRNA_F-distichus_contig100.4.1|organism=Fucus distichus monoicous|type=CDS|length=708bp|location=Sequence derived from alignment at F-distichus_contig100:1268..1773+ (Fucus distichus monoicous)back to top |