EsuBft207_24 (polypeptide) Ectocarpus subulatus male Bft15b
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of EsuBft207_24a-0001 vs. uniprot
Match: A0A6H5K436_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K436_9PHAE) HSP 1 Score: 107 bits (267), Expect = 1.110e-29 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0 Query: 1 MPLEKMRRDVLFSVGHVNINPRHHAAEEQQGLRHANSFGLAIYMMLAVSAAAAL 54 MPLEKMRRDVLFSVGHVNINPRHHAAEEQQGLRHANSFGLAIYMMLAVSAAAAL Sbjct: 1 MPLEKMRRDVLFSVGHVNINPRHHAAEEQQGLRHANSFGLAIYMMLAVSAAAAL 54
BLAST of EsuBft207_24a-0001 vs. uniprot
Match: A0A6H5JK55_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK55_9PHAE) HSP 1 Score: 45.4 bits (106), Expect = 7.810e-5 Identity = 24/24 (100.00%), Postives = 24/24 (100.00%), Query Frame = 0 Query: 31 GLRHANSFGLAIYMMLAVSAAAAL 54 GLRHANSFGLAIYMMLAVSAAAAL Sbjct: 60 GLRHANSFGLAIYMMLAVSAAAAL 83
BLAST of EsuBft207_24a-0001 vs. uniprot
Match: A0A6H5K436_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K436_9PHAE) HSP 1 Score: 108 bits (270), Expect = 3.900e-28 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 3 Query: 222 MPLEKMRRDVLFSVGHVNINPRHHAAEEQQGLRHANSFGLAIYMMLAVSAAAAL 383 MPLEKMRRDVLFSVGHVNINPRHHAAEEQQGLRHANSFGLAIYMMLAVSAAAAL Sbjct: 1 MPLEKMRRDVLFSVGHVNINPRHHAAEEQQGLRHANSFGLAIYMMLAVSAAAAL 54
BLAST of EsuBft207_24a-0001 vs. uniprot
Match: A0A6H5LIG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LIG2_9PHAE) HSP 1 Score: 90.9 bits (224), Expect = 5.760e-21 Identity = 46/68 (67.65%), Postives = 52/68 (76.47%), Query Frame = -3 Query: 149 MANPKELACRRPCCSSAAWCRGLMLTCPTENRTSRRIFSNGIVW*GGTRLSHTLLS--STQAPNTHEA 346 MANPKELACRRPCCSSAAWCRG+MLTCPT+NRTSR IFSNGI+ T L+ + STQ P + A Sbjct: 1 MANPKELACRRPCCSSAAWCRGVMLTCPTKNRTSRHIFSNGILVRRHTSLTQLIEQQPSTQYPRSSTA 68
BLAST of EsuBft207_24a-0001 vs. uniprot
Match: A0A6H5KXX8_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXX8_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 1.050e-5 Identity = 24/26 (92.31%), Postives = 25/26 (96.15%), Query Frame = -2 Query: 267 GQSERISVSEALLLFCCVVPWIDVDM 344 GQSERISVSEALLLFCCVVPW DVD+ Sbjct: 8 GQSERISVSEALLLFCCVVPWSDVDV 33 The following BLAST results are available for this feature:
BLAST of EsuBft207_24a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
BLAST of EsuBft207_24a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft207_24 ID=EsuBft207_24|Name=EsuBft207_24a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=54bpback to top |