EsuBft1510_4 (polypeptide) Ectocarpus subulatus male Bft15b
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of EsuBft1510_4a-0001 vs. uniprot
Match: A0A6H5JJ65_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ65_9PHAE) HSP 1 Score: 117 bits (292), Expect = 1.940e-33 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0 Query: 1 MVTWHMGVMPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSFVSAIIK 56 MVTWHMGVMPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSFVSAIIK Sbjct: 1 MVTWHMGVMPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSFVSAIIK 56
BLAST of EsuBft1510_4a-0001 vs. uniprot
Match: D7FUH4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUH4_ECTSI) HSP 1 Score: 79.3 bits (194), Expect = 5.390e-16 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 9 MPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSF 50 M A V YTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSF Sbjct: 5 MAAAGVGYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSF 46
BLAST of EsuBft1510_4a-0001 vs. uniprot
Match: D7FPX3_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FPX3_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 9.090e-11 Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = 0 Query: 9 MPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSW 48 M V + AINVAMGNTR APYSYCV+AHAGL+AD++SW Sbjct: 255 MAATGVKFEAINVAMGNTRVAPYSYCVEAHAGLEADLISW 294
BLAST of EsuBft1510_4a-0001 vs. uniprot
Match: A0A6H5JJ65_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ65_9PHAE) HSP 1 Score: 117 bits (293), Expect = 3.510e-28 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 1 Query: 1 MVTWHMGVMPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSFVSAIIK 168 MVTWHMGVMPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSFVSAIIK Sbjct: 1 MVTWHMGVMPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSFVSAIIK 56
BLAST of EsuBft1510_4a-0001 vs. uniprot
Match: D7FUH4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUH4_ECTSI) HSP 1 Score: 79.7 bits (195), Expect = 4.700e-12 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 1 Query: 25 MPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSF 150 M A V YTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSF Sbjct: 5 MAAAGVGYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSWSF 46
BLAST of EsuBft1510_4a-0001 vs. uniprot
Match: D7FPX3_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FPX3_ECTSI) HSP 1 Score: 65.1 bits (157), Expect = 3.950e-7 Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = 1 Query: 25 MPVAEVTYTAINVAMGNTRAAPYSYCVDAHAGLDADIVSW 144 M V + AINVAMGNTR APYSYCV+AHAGL+AD++SW Sbjct: 255 MAATGVKFEAINVAMGNTRVAPYSYCVEAHAGLEADLISW 294 The following BLAST results are available for this feature:
BLAST of EsuBft1510_4a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
BLAST of EsuBft1510_4a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft1510_4 ID=EsuBft1510_4|Name=EsuBft1510_4a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=56bpback to top |