EsuBft759_8a-0001 (mRNA) Ectocarpus subulatus male Bft15b
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >EsuBft759_8a-0001 ID=EsuBft759_8a-0001|Name=EsuBft759_8a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=261bp|location=Sequence derived from alignment at Scaffold_561:317686..317946- (Ectocarpus subulatus male Bft15b)|Notes=Excludes all bases but those of type(s): exon. ATGTCGGACACCCCTGAGGGACTGCAACTGCAAATTGACGCGGCGAAGAAback to top protein sequence of EsuBft759_8a-0001 >EsuBft759_8 ID=EsuBft759_8|Name=EsuBft759_8a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=87bp MSDTPEGLQLQIDAAKKFTDKWRLSANVQKSAVMVCNENKEEPVEHRWKWback to top mRNA from alignment at Scaffold_561:317686..317946- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>EsuBft759_8a-0001 ID=EsuBft759_8a-0001|Name=EsuBft759_8a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=261bp|location=Sequence derived from alignment at Scaffold_561:317686..317946- (Ectocarpus subulatus male Bft15b)back to top Coding sequence (CDS) from alignment at Scaffold_561:317686..317946- >EsuBft759_8a-0001 ID=EsuBft759_8a-0001|Name=EsuBft759_8a-0001|organism=Ectocarpus subulatus male Bft15b|type=CDS|length=261bp|location=Sequence derived from alignment at Scaffold_561:317686..317946- (Ectocarpus subulatus male Bft15b)back to top |