EsuBft2064_4a-0001 (mRNA) Ectocarpus subulatus male Bft15b
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >EsuBft2064_4a-0001 ID=EsuBft2064_4a-0001|Name=EsuBft2064_4a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=684bp|location=Sequence derived from alignment at Scaffold_347:32421..33104- (Ectocarpus subulatus male Bft15b)|Notes=Excludes all bases but those of type(s): exon. ATGGCCGTACTCTCTGCTTCTGCTTCCCTCGCGCGCTGGCGCTTCGCGGAback to top protein sequence of EsuBft2064_4a-0001 >EsuBft2064_4 ID=EsuBft2064_4|Name=EsuBft2064_4a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=130bp MAVLSASASLARWRFADASASCLCHFLMSHAAPSSTLLYHTSGSLALSFHback to top mRNA from alignment at Scaffold_347:32421..33104- Legend: exonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>EsuBft2064_4a-0001 ID=EsuBft2064_4a-0001|Name=EsuBft2064_4a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=684bp|location=Sequence derived from alignment at Scaffold_347:32421..33104- (Ectocarpus subulatus male Bft15b)back to top Coding sequence (CDS) from alignment at Scaffold_347:32421..33104- >EsuBft2064_4a-0001 ID=EsuBft2064_4a-0001|Name=EsuBft2064_4a-0001|organism=Ectocarpus subulatus male Bft15b|type=CDS|length=393bp|location=Sequence derived from alignment at Scaffold_347:32421..33104- (Ectocarpus subulatus male Bft15b)back to top |