EsuBft1332_2a-0001 (mRNA) Ectocarpus subulatus male Bft15b
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >EsuBft1332_2a-0001 ID=EsuBft1332_2a-0001|Name=EsuBft1332_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=332bp|location=Sequence derived from alignment at Scaffold_94:364095..364426+ (Ectocarpus subulatus male Bft15b)|Notes=Excludes all bases but those of type(s): exon. ATGAGCGGAGAACTGAAAGTAAAGGGCGTGACAGTATTCGGCCCAGGAGGback to top protein sequence of EsuBft1332_2a-0001 >EsuBft1332_2 ID=EsuBft1332_2|Name=EsuBft1332_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=77bp MSGELKVKGVTVFGPGGRSHRPSTCTLCTKLSKLFCVTPLERSLGQLQQGback to top mRNA from alignment at Scaffold_94:364095..364426+ Legend: exonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>EsuBft1332_2a-0001 ID=EsuBft1332_2a-0001|Name=EsuBft1332_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=332bp|location=Sequence derived from alignment at Scaffold_94:364095..364426+ (Ectocarpus subulatus male Bft15b)back to top Coding sequence (CDS) from alignment at Scaffold_94:364095..364426+ >EsuBft1332_2a-0001 ID=EsuBft1332_2a-0001|Name=EsuBft1332_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=CDS|length=234bp|location=Sequence derived from alignment at Scaffold_94:364095..364426+ (Ectocarpus subulatus male Bft15b)back to top |