EsuBft1086_3a-0001 (mRNA) Ectocarpus subulatus male Bft15b
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >EsuBft1086_3a-0001 ID=EsuBft1086_3a-0001|Name=EsuBft1086_3a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=210bp|location=Sequence derived from alignment at Scaffold_133:493164..493720+ (Ectocarpus subulatus male Bft15b)|Notes=Excludes all bases but those of type(s): exon. ATGCTGCGACACGTGGCAATGGGATACTCGGTGCACATGCAGCGCCTTCTback to top protein sequence of EsuBft1086_3a-0001 >EsuBft1086_3 ID=EsuBft1086_3|Name=EsuBft1086_3a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=69bp MLRHVAMGYSVHMQRLLGHLTWWIFPLLMPGYTDLTKDGKELRANVFISCback to top mRNA from alignment at Scaffold_133:493164..493720+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>EsuBft1086_3a-0001 ID=EsuBft1086_3a-0001|Name=EsuBft1086_3a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=557bp|location=Sequence derived from alignment at Scaffold_133:493164..493720+ (Ectocarpus subulatus male Bft15b)back to top Coding sequence (CDS) from alignment at Scaffold_133:493164..493720+ >EsuBft1086_3a-0001 ID=EsuBft1086_3a-0001|Name=EsuBft1086_3a-0001|organism=Ectocarpus subulatus male Bft15b|type=CDS|length=210bp|location=Sequence derived from alignment at Scaffold_133:493164..493720+ (Ectocarpus subulatus male Bft15b)back to top |