EsuBft1047_2a-0001 (mRNA) Ectocarpus subulatus male Bft15b
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >EsuBft1047_2a-0001 ID=EsuBft1047_2a-0001|Name=EsuBft1047_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=433bp|location=Sequence derived from alignment at Scaffold_512:474392..474824- (Ectocarpus subulatus male Bft15b)|Notes=Excludes all bases but those of type(s): exon. GGGGGGAAGGGTACGCTCACACGCTCCCGAGGGGACGCGTGGGGGGTGGAback to top protein sequence of EsuBft1047_2a-0001 >EsuBft1047_2 ID=EsuBft1047_2|Name=EsuBft1047_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=57bp MGTKKGRQMGTKKGRQKGTKEERLNKETEGEKEETWAVTHPRRVGRRISMback to top mRNA from alignment at Scaffold_512:474392..474824- Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>EsuBft1047_2a-0001 ID=EsuBft1047_2a-0001|Name=EsuBft1047_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=433bp|location=Sequence derived from alignment at Scaffold_512:474392..474824- (Ectocarpus subulatus male Bft15b)back to top Coding sequence (CDS) from alignment at Scaffold_512:474392..474824- >EsuBft1047_2a-0001 ID=EsuBft1047_2a-0001|Name=EsuBft1047_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=CDS|length=174bp|location=Sequence derived from alignment at Scaffold_512:474392..474824- (Ectocarpus subulatus male Bft15b)back to top |