mRNA_Ecto-sp8_S_contig100076.25.1 (mRNA) Ectocarpus species8 EcLAC_412
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp8_S_contig100076.25.1 vs. uniprot
Match: UPI0010A9E817 (autotransporter domain-containing protein n=1 Tax=Nitratireductor sp. XY-223 TaxID=2561926 RepID=UPI0010A9E817) HSP 1 Score: 56.2 bits (134), Expect = 1.740e-6 Identity = 29/84 (34.52%), Postives = 46/84 (54.76%), Query Frame = 1 Query: 4 SIGAGYKGVFLDGYTETGASSNLTIETRDVHFLLANTQVDMIADFKTATGQTISFRPYIGIEGSFAIGTNTATASLSGASSSFN 255 S+G Y G+FLDGYTE+G+S+NLT+ +R H + +A + +S + GI+G F G N + +GA +F+ Sbjct: 633 SVGGHYAGLFLDGYTESGSSANLTVASRAAHVAAVRAKATYLAGQQQMWNGLVSVETWAGIDGVFNFGDNVEASVAAGAFDAFS 716
BLAST of mRNA_Ecto-sp8_S_contig100076.25.1 vs. uniprot
Match: UPI00145A346A (autotransporter domain-containing protein n=1 Tax=Nitratireductor sp. XY-223 TaxID=2561926 RepID=UPI00145A346A) HSP 1 Score: 53.1 bits (126), Expect = 2.030e-5 Identity = 28/84 (33.33%), Postives = 45/84 (53.57%), Query Frame = 1 Query: 4 SIGAGYKGVFLDGYTETGASSNLTIETRDVHFLLANTQVDMIADFKTATGQTISFRPYIGIEGSFAIGTNTATASLSGASSSFN 255 S+G Y G+FLDGYTE+G+S+NLT+ R H + +A + +S + GI+G F G + + +GA +F+ Sbjct: 586 SVGGHYAGLFLDGYTESGSSTNLTVAGRAAHVAAVRAKATYLAGQQQMWNGLVSVETWAGIDGVFNFGDDVEASVAAGAFDAFS 669 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp8_S_contig100076.25.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp8_S_contig100076.25.1 >prot_Ecto-sp8_S_contig100076.25.1 ID=prot_Ecto-sp8_S_contig100076.25.1|Name=mRNA_Ecto-sp8_S_contig100076.25.1|organism=Ectocarpus species8 EcLAC_412|type=polypeptide|length=138bp PSIGAGYKGVFLDGYTETGASSNLTIETRDVHFLLANTQVDMIADFKTATback to top mRNA from alignment at Ecto-sp8_S_contig100076:1..414+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp8_S_contig100076.25.1 ID=mRNA_Ecto-sp8_S_contig100076.25.1|Name=mRNA_Ecto-sp8_S_contig100076.25.1|organism=Ectocarpus species8 EcLAC_412|type=mRNA|length=414bp|location=Sequence derived from alignment at Ecto-sp8_S_contig100076:1..414+ (Ectocarpus species8 EcLAC_412)back to top Coding sequence (CDS) from alignment at Ecto-sp8_S_contig100076:1..414+ >mRNA_Ecto-sp8_S_contig100076.25.1 ID=mRNA_Ecto-sp8_S_contig100076.25.1|Name=mRNA_Ecto-sp8_S_contig100076.25.1|organism=Ectocarpus species8 EcLAC_412|type=CDS|length=414bp|location=Sequence derived from alignment at Ecto-sp8_S_contig100076:1..414+ (Ectocarpus species8 EcLAC_412)back to top |